Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: EXOSC9Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human EXOSC9 Polyclonal Antibody | anti-EXOSC9 antibody

EXOSC9 Antibody - middle region

Gene Names
EXOSC9; p5; p6; PCH1D; RRP45; PMSCL1; Rrp45p; PM/Scl-75
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
EXOSC9; Polyclonal Antibody; EXOSC9 Antibody - middle region; anti-EXOSC9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IIAEAEPPSEVVSTPVLWTPGTAQIGEGVENSWGDLEDSEKEDDEGGGDQ
Sequence Length
439
Applicable Applications for anti-EXOSC9 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EXOSC9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: EXOSC9Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: EXOSC9Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-EXOSC9 antibody
This gene encodes a component of the human exosome, a exoribonuclease complex which processes and degrades RNA in the nucleus and cytoplasm. This component may play a role in mRNA degradation and the polymyositis/scleroderma autoantigen complex. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-EXOSC9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48 kDa
NCBI Official Full Name
exosome complex component RRP45 isoform 1
NCBI Official Synonym Full Names
exosome component 9
NCBI Official Symbol
EXOSC9
NCBI Official Synonym Symbols
p5; p6; PCH1D; RRP45; PMSCL1; Rrp45p; PM/Scl-75
NCBI Protein Information
exosome complex component RRP45
UniProt Protein Name
Exosome complex component RRP45
Protein Family
UniProt Gene Name
EXOSC9
UniProt Synonym Gene Names
PMSCL1; PM/Scl-75
UniProt Entry Name
EXOS9_HUMAN

NCBI Description

This gene encodes a component of the human exosome, a exoribonuclease complex which processes and degrades RNA in the nucleus and cytoplasm. This component may play a role in mRNA degradation and the polymyositis/scleroderma autoantigen complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011]

Uniprot Description

EXOSC9: Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. EXOSC9 binds to ARE-containing RNAs. Belongs to the RNase PH family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.13.-; Ribonuclease; RNA processing; Nucleolus

Chromosomal Location of Human Ortholog: 4q27

Cellular Component: nucleoplasm; nuclear chromosome; intermediate filament cytoskeleton; cytoplasm; nucleolus; exosome (RNase complex); nucleus; cytosol; nuclear exosome (RNase complex)

Molecular Function: protein binding; 3'-5'-exoribonuclease activity; exoribonuclease activity; RNA binding; AU-rich element binding

Biological Process: immune response; gene expression; positive regulation of cell growth; rRNA processing; mRNA catabolic process, deadenylation-dependent decay

Research Articles on EXOSC9

Similar Products

Product Notes

The EXOSC9 exosc9 (Catalog #AAA3222112) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EXOSC9 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EXOSC9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EXOSC9 exosc9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IIAEAEPPSE VVSTPVLWTP GTAQIGEGVE NSWGDLEDSE KEDDEGGGDQ. It is sometimes possible for the material contained within the vial of "EXOSC9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.