Western Blot (WB)
(Host: RabbitTarget Name: EXD2Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human EXD2 Polyclonal Antibody | anti-EXD2 antibody
EXD2 Antibody - middle region
Gene Names
EXD2; EXDL2; C14orf114
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
EXD2; Polyclonal Antibody; EXD2 Antibody - middle region; anti-EXD2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EEVNGEATESQQKPRNKKSKMDGMVPGNHQGRDPRKHKRKPLGVGYSARK
Sequence Length
496
Applicable Applications for anti-EXD2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of human EXD2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: EXD2Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: EXD2Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-EXD2 antibody
Exonuclease required for double-strand breaks resection and efficient homologous recombination. Plays a key role in controlling the initial steps of chromosomal break repair, it is recruited to chromatin in a damage-dependent manner and functionally interacts with the MRN complex to accelerate resection through its 3'-5' exonuclease activity, which efficiently processes double-stranded DNA substrates containing nicks.
Product Categories/Family for anti-EXD2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54 kDa
NCBI Official Full Name
exonuclease 3'-5' domain-containing protein 2 isoform 1
NCBI Official Synonym Full Names
exonuclease 3'-5' domain containing 2
NCBI Official Symbol
EXD2
NCBI Official Synonym Symbols
EXDL2; C14orf114
NCBI Protein Information
exonuclease 3'-5' domain-containing protein 2
UniProt Protein Name
Exonuclease 3'-5' domain-containing protein 2
Protein Family
UniProt Gene Name
EXD2
UniProt Synonym Gene Names
C14orf114; EXDL2
UniProt Entry Name
EXD2_HUMAN
Uniprot Description
EXDL2: Belongs to the EXD2 family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 14q24.1
Cellular Component: cytoplasm; nucleus
Molecular Function: nucleic acid binding; 3'-5' exonuclease activity
Research Articles on EXD2
Similar Products
Product Notes
The EXD2 exd2 (Catalog #AAA3222942) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EXD2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EXD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EXD2 exd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EEVNGEATES QQKPRNKKSK MDGMVPGNHQ GRDPRKHKRK PLGVGYSARK. It is sometimes possible for the material contained within the vial of "EXD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
