Western Blot (WB)
(WB Suggested Anti-EVX2 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Rabbit EVX2 Polyclonal Antibody | anti-EVX2 antibody
EVX2 antibody - N-terminal region
Gene Names
EVX2; EVX-2
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
EVX2; Polyclonal Antibody; EVX2 antibody - N-terminal region; anti-EVX2 antibody
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MMERIRKEMILMERGLHSPTAGKRFSNLSNSAGNAVLEALENSQHPARLS
Sequence Length
476
Applicable Applications for anti-EVX2 antibody
Western Blot (WB)
Homology
Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LOC344191
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-EVX2 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-EVX2 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-EVX2 antibody
This is a rabbit polyclonal antibody against LOC344191. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: LOC344191 is a new candidate transcription factor.
Target Description: LOC344191 is a new candidate transcription factor.
Product Categories/Family for anti-EVX2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
homeobox even-skipped homolog protein 2
NCBI Official Synonym Full Names
even-skipped homeobox 2
NCBI Official Symbol
EVX2
NCBI Official Synonym Symbols
EVX-2
NCBI Protein Information
homeobox even-skipped homolog protein 2
UniProt Protein Name
Homeobox even-skipped homolog protein 2
Protein Family
UniProt Gene Name
EVX2
UniProt Entry Name
EVX2_HUMAN
NCBI Description
This gene is located at the 5' end of the HOXD gene cluster on chromosome 2. The encoded protein is a homeobox transcription factor that is related to the protein encoded by the Drosophila even-skipped (eve) gene, a member of the pair-rule class of segmentation genes. A 117 kb microdeletion at the 5' end of the HOXD gene cluster, which includes this gene and the HOXD9-HOXD13 genes, causes synpolydactyly, a dominantly inherited disease resulting in limb malformation. [provided by RefSeq, Sep 2009]
Research Articles on EVX2
Similar Products
Product Notes
The EVX2 evx2 (Catalog #AAA3205015) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EVX2 antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EVX2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EVX2 evx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MMERIRKEMI LMERGLHSPT AGKRFSNLSN SAGNAVLEAL ENSQHPARLS. It is sometimes possible for the material contained within the vial of "EVX2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
