Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ETS2 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)

Rabbit ETS2 Polyclonal Antibody | anti-ETS2 antibody

ETS2 antibody - middle region

Gene Names
Trp63; Ket; P63; P73l; Tp63; P51/P63; AI462811; Trp53rp1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ETS2; Polyclonal Antibody; ETS2 antibody - middle region; anti-ETS2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGS
Sequence Length
469
Applicable Applications for anti-ETS2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%; Sheep: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ETS2 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)

Western Blot (WB) (WB Suggested Anti-ETS2 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)
Related Product Information for anti-ETS2 antibody
This is a rabbit polyclonal antibody against ETS2. It was validated on Western Blot

Target Description: ETS2 contains an ETS DNA-binding domain and belongs to the ETS family. ETS2 is a target of protein kinase C and upregulates GM-CSF. Ets2 and its targets play essential roles in endothelial cell function. Coexpression of Ets-2 and SRC-1 significantly associated with the rate of recurrence and HER expression in breast cancer. Overexpression of ETS2 is associated with human esophageal squamous cell carcinoma.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
tumor protein 63 isoform f
NCBI Official Synonym Full Names
transformation related protein 63
NCBI Official Symbol
Trp63
NCBI Official Synonym Symbols
Ket; P63; P73l; Tp63; P51/P63; AI462811; Trp53rp1
NCBI Protein Information
tumor protein 63
UniProt Protein Name
Protein C-ets-2
Protein Family
UniProt Gene Name
ETS2
UniProt Entry Name
ETS2_HUMAN

NCBI Description

This gene encodes tumor protein p63, a member of the p53 family of transcription factors involved in cellular responses to stress and development. The family members include tumor proteins p53, p63, and p73, which have high sequence similarity to one another. This similarity allows p63 and p73 to transactivate p53-responsive genes causing cell cycle arrest and apoptosis. The family members can interact with each other in many ways, including direct and indirect protein interactions. This results in mutual regulation of target gene promoters. Tumor protein p63 -/- mice have several developmental defects which include the lack of limbs and other tissues, such as teeth and mammary glands, which develop as a result of interactions between mesenchyme and epithelium. Both alternative splicing and the use of alternative promoters result in multiple transcript variants encoding different protein isoforms.[provided by RefSeq, Dec 2009]

Uniprot Description

Ets-2: a proto-oncogenic transcription factor homologous to the v-ets erythroblastosis virus E26 oncogene. A target of the Akt/JNK signaling pathway in macrophages. A PKC pathway activates ETS2, up-regulating GM-CSF in non-small lung carcinoma cells.

Protein type: Transcription factor; Oncoprotein; DNA-binding

Chromosomal Location of Human Ortholog: 21q22.2

Cellular Component: nucleoplasm; nucleus

Molecular Function: protein binding; DNA binding; transcription factor activity; glucocorticoid receptor binding

Biological Process: transcription from RNA polymerase II promoter; regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; cell differentiation; skeletal development

Research Articles on ETS2

Similar Products

Product Notes

The ETS2 ets2 (Catalog #AAA3200334) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ETS2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's ETS2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ETS2 ets2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FESFEDDCSQ SLCLNKPTMS FKDYIQERSD PVEQGKPVIP AAVLAGFTGS. It is sometimes possible for the material contained within the vial of "ETS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.