Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-EG546729 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Intestine)

Rabbit EG546729 Polyclonal Antibody | anti-CALHM1 antibody

EG546729 antibody - C-terminal region

Gene Names
Calhm1; EG546729
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EG546729; Polyclonal Antibody; EG546729 antibody - C-terminal region; anti-CALHM1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GITDQGTMNRLLTSWHKCKPPLRLGQEAPLMSNGWAGGEPRPPRKEVATY
Sequence Length
348
Applicable Applications for anti-CALHM1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Horse: 85%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 93%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-EG546729 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Intestine)

Western Blot (WB) (WB Suggested Anti-EG546729 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Intestine)
Related Product Information for anti-CALHM1 antibody
This is a rabbit polyclonal antibody against EG546729. It was validated on Western Blot

Target Description: The function of this protein remains unknown.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
calcium homeostasis modulator protein 1
NCBI Official Synonym Full Names
calcium homeostasis modulator 1
NCBI Official Symbol
Calhm1
NCBI Official Synonym Symbols
EG546729
NCBI Protein Information
calcium homeostasis modulator protein 1
UniProt Protein Name
Calcium homeostasis modulator protein 1
UniProt Gene Name
Calhm1
UniProt Entry Name
CAHM1_MOUSE

Uniprot Description

CALHM1: May be a pore-forming ion channel. Controls cytosolic Ca(2+) permeability and cytosolic Ca(2+) concentration. Controls amyloid precursor protein (APP) proteolysis and aggregated amyloid-beta (Abeta) peptides levels in a Ca(2+) dependent manner. Belongs to the FAM26 family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Channel, calcium

Cellular Component: membrane; endoplasmic reticulum; integral to plasma membrane; integral to membrane; plasma membrane

Molecular Function: identical protein binding; calcium channel activity; voltage-gated ion channel activity; cation channel activity; calcium activated cation channel activity

Biological Process: ATP transport; sensory perception of umami taste; sensory perception of sweet taste; transport; calcium ion transport; sensory perception of bitter taste; ion transport; cation transport; protein homooligomerization

Research Articles on CALHM1

Similar Products

Product Notes

The CALHM1 calhm1 (Catalog #AAA3207348) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EG546729 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EG546729 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CALHM1 calhm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GITDQGTMNR LLTSWHKCKP PLRLGQEAPL MSNGWAGGEP RPPRKEVATY. It is sometimes possible for the material contained within the vial of "EG546729, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.