Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-ETS1 Polyclonal Antibody)

Rabbit ETS1 Polyclonal Antibody | anti-ETS1 antibody

ETS1 Polyclonal Antibody

Gene Names
ETS1; p54; ETS-1; EWSR2; c-ets-1
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purification
Synonyms
ETS1; Polyclonal Antibody; ETS1 Polyclonal Antibody; ETS-1; EWSR2; c-ets-1; p54; protein C-ets-1; anti-ETS1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.5 mg/ml (varies by lot)
Sequence Length
485
Applicable Applications for anti-ETS1 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500-1:2000
IHC: 1:100-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human ETS1 (NP_005229.1).
Immunogen Sequence
MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDS
Positive Samples
Mouse Thymus
Cellular Location
Cytoplasm, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-ETS1 Polyclonal Antibody)

Western Blot (WB) (Western blot-ETS1 Polyclonal Antibody)
Related Product Information for anti-ETS1 antibody
This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 25kDa; 30kDa; 40kDa; 50kDa; 55kDa
Observed: 56kDa
NCBI Official Full Name
protein C-ets-1 isoform 1
NCBI Official Synonym Full Names
ETS proto-oncogene 1, transcription factor
NCBI Official Symbol
ETS1
NCBI Official Synonym Symbols
p54; ETS-1; EWSR2; c-ets-1
NCBI Protein Information
protein C-ets-1
UniProt Protein Name
Protein C-ets-1
Protein Family
UniProt Gene Name
ETS1
UniProt Synonym Gene Names
EWSR2
UniProt Entry Name
ETS1_HUMAN

NCBI Description

This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011]

Uniprot Description

Ets-1: a proto-oncogenic transcription factor homologous to the v-ets erythroblastosis virus oncogene. The DNA binding activity of Ets1 is controlled by kinases and transcription factors. It contributes to the regulation of cellular differentiation in hematopoietic cells. Ets1 promotes invasive behavior in endothelial cells, vascular smooth muscle cells and epithelial cancer cells. Regulates the expression of MMP1, MMP3, MMP9 and uPA as well as of VEGF and VEGFR gene expression. Two alternatively spliced isoforms have been described.

Protein type: Oncoprotein; Transcription factor; Motility/polarity/chemotaxis; DNA-binding

Chromosomal Location of Human Ortholog: 11q23.3

Cellular Component: nucleoplasm; transcription factor complex; intercellular bridge; cytoplasm; nucleus

Molecular Function: histone acetyltransferase binding; protein binding; DNA binding; sequence-specific DNA binding; transcription factor activity; transcription factor binding

Biological Process: transcription from RNA polymerase II promoter; hypothalamus development; positive regulation of transcription, DNA-dependent; positive regulation of erythrocyte differentiation; cell motility involved in cell locomotion; PML body organization and biogenesis; positive regulation of cell motility; female pregnancy; angiogenesis involved in wound healing; regulation of angiogenesis; response to estradiol stimulus; negative regulation of cell cycle; response to antibiotic; regulation of apoptosis; negative regulation of cell proliferation; positive regulation of angiogenesis; response to mechanical stimulus; pituitary gland development; positive regulation of cell proliferation; response to hypoxia; positive regulation of transcription from RNA polymerase II promoter; immune response

Research Articles on ETS1

Similar Products

Product Notes

The ETS1 ets1 (Catalog #AAA9140411) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ETS1 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ETS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500-1:2000 IHC: 1:100-1:200. Researchers should empirically determine the suitability of the ETS1 ets1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ETS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.