Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ESX1 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Rabbit anti-Human ESX1 Polyclonal Antibody | anti-ESX1 antibody

ESX1 antibody - N-terminal region

Gene Names
ESX1; ESX1L; ESXR1
Reactivity
Human
Applications
Western Blot
Purity
Protein A purified
Synonyms
ESX1; Polyclonal Antibody; ESX1 antibody - N-terminal region; anti-ESX1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SLMARGGEDEENTRSKPEYGTEAENNVGTEGSVPSDDQDREGGGGHEPEQ
Sequence Length
406
Applicable Applications for anti-ESX1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ESX1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ESX1 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-ESX1 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)
Related Product Information for anti-ESX1 antibody
This is a rabbit polyclonal antibody against ESX1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ESX1 is a homeobox gene related to the mouse Esx1 homeobox gene. ESX1 is expressed during all stages of placental development and is localized to sparse areas of trophoblast in terminal villi in association with cytotrophoblastic cells. Proteolytic processing of ESX1 plays a role in concerted regulation of the cell cycle and transcription in human cells.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
homeobox protein ESX1
NCBI Official Synonym Full Names
ESX homeobox 1
NCBI Official Symbol
ESX1
NCBI Official Synonym Symbols
ESX1L; ESXR1
NCBI Protein Information
homeobox protein ESX1
UniProt Protein Name
Homeobox protein ESX1
Protein Family
UniProt Gene Name
ESX1
UniProt Synonym Gene Names
ESX1L; ESX1R
UniProt Entry Name
ESX1_HUMAN

NCBI Description

This gene encodes a dual-function 65 kDa protein that undergoes proteolytic cleavage to produce a 45 kDa N-terminal fragment with a paired-like homeodomain and a 20 kDa C-terminal fragment with a proline-rich domain. The C-terminal fragment localizes to the cytoplasm while the N-terminal fragment localizes exclusively to the nucleus. In contrast to human, the mouse homolog has a novel PN/PF motif in the C-terminus and is paternally imprinted in placental tissue. This gene likely plays a role in placental development and spermatogenesis. [provided by RefSeq, Jan 2010]

Uniprot Description

ESX1L: May coordinately regulate cell cycle progression and transcription during spermatogenesis. Inhibits degradation of polyubiquitinated cyclin A and cyclin B1 and thereby arrests the cell cycle at early M phase. ESXR1-N acts as a transcriptional repressor. Binds to the sequence 5'-TAATGTTATTA-3' which is present within the first intron of the KRAS gene and inhibits its expression. ESXR1-C has the ability to inhibit cyclin turnover.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: Xq22.1

Cellular Component: cytoplasm; nucleus

Molecular Function: sequence-specific DNA binding

Biological Process: transcription, DNA-dependent; regulation of cell cycle; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent

Research Articles on ESX1

Similar Products

Product Notes

The ESX1 esx1 (Catalog #AAA3203027) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ESX1 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ESX1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ESX1 esx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SLMARGGEDE ENTRSKPEYG TEAENNVGTE GSVPSDDQDR EGGGGHEPEQ. It is sometimes possible for the material contained within the vial of "ESX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.