Western Blot (WB)
(WB Suggested Anti-ESF1 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellESF1 is supported by BioGPS gene expression data to be expressed in MCF7)
Rabbit ESF1 Polyclonal Antibody | anti-ESF1 antibody
ESF1 Antibody - C-terminal region
Gene Names
ESF1; ABTAP; C20orf6; HDCMC28P; bA526K24.1
Reactivity
Dog, Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ESF1; Polyclonal Antibody; ESF1 Antibody - C-terminal region; anti-ESF1 antibody
Host
Rabbit
Reactivity
Dog, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QELTQAIKKKESEIEKESQRKSIDPALSMLIKSIKTKTEQFQARKKQKVK
Sequence Length
851
Applicable Applications for anti-ESF1 antibody
Western Blot (WB)
Homology
Dog: 79%; Horse: 79%; Human: 100%; Pig: 86%; Rabbit: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ESF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ESF1 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellESF1 is supported by BioGPS gene expression data to be expressed in MCF7)
Western Blot (WB)
(WB Suggested Anti-ESF1 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellESF1 is supported by BioGPS gene expression data to be expressed in MCF7)
Related Product Information for anti-ESF1 antibody
This is a rabbit polyclonal antibody against ESF1. It was validated on Western Blot
Target Description: ESF1 may constitute a novel regulatory system for basal transcription and negatively regulates ABT1.
Target Description: ESF1 may constitute a novel regulatory system for basal transcription and negatively regulates ABT1.
Product Categories/Family for anti-ESF1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
99kDa
NCBI Official Full Name
ESF1 homolog
NCBI Official Synonym Full Names
ESF1 nucleolar pre-rRNA processing protein homolog
NCBI Official Symbol
ESF1
NCBI Official Synonym Symbols
ABTAP; C20orf6; HDCMC28P; bA526K24.1
NCBI Protein Information
ESF1 homolog
UniProt Protein Name
ESF1 homolog
Protein Family
UniProt Gene Name
ESF1
UniProt Synonym Gene Names
ABTAP; C20orf6
UniProt Entry Name
ESF1_HUMAN
Uniprot Description
ESF1: May constitute a novel regulatory system for basal transcription. Negatively regulates ABT1. Belongs to the ESF1 family.
Protein type: Nucleolus; Transcription, coactivator/corepressor
Chromosomal Location of Human Ortholog: 20p12.1
Cellular Component: extracellular space
Research Articles on ESF1
Similar Products
Product Notes
The ESF1 esf1 (Catalog #AAA3217070) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ESF1 Antibody - C-terminal region reacts with Dog, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ESF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ESF1 esf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QELTQAIKKK ESEIEKESQR KSIDPALSML IKSIKTKTEQ FQARKKQKVK. It is sometimes possible for the material contained within the vial of "ESF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
