Western Blot (WB)
(WB Suggested Anti-ARHGAP19 AntibodyTitration: 1.0 ug/mlPositive Control: PANC1 Whole CellARHGAP19 is supported by BioGPS gene expression data to be expressed in PANC1)
Rabbit ARHGAP19 Polyclonal Antibody | anti-ARHGAP19 antibody
ARHGAP19 antibody - C-terminal region
Reactivity
Cow, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ARHGAP19; Polyclonal Antibody; ARHGAP19 antibody - C-terminal region; anti-ARHGAP19 antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QFNKQSLTQTPGREPSTSQVQKRARSRSFSGLIKRKVLGNQMMSEKKKKN
Sequence Length
494
Applicable Applications for anti-ARHGAP19 antibody
Western Blot (WB)
Homology
Cow: 79%; Guinea Pig: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ARHGAP19
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ARHGAP19 AntibodyTitration: 1.0 ug/mlPositive Control: PANC1 Whole CellARHGAP19 is supported by BioGPS gene expression data to be expressed in PANC1)
Western Blot (WB)
(WB Suggested Anti-ARHGAP19 AntibodyTitration: 1.0 ug/mlPositive Control: PANC1 Whole CellARHGAP19 is supported by BioGPS gene expression data to be expressed in PANC1)
Related Product Information for anti-ARHGAP19 antibody
This is a rabbit polyclonal antibody against ARHGAP19. It was validated on Western Blot
Target Description: Members of the ARHGAP family, such as ARHGAP19, encode negative regulators of Rho GTPases, which are involved in cell migration, proliferation, and differentiation, actin remodeling, and G1 cell cycle progression.
Target Description: Members of the ARHGAP family, such as ARHGAP19, encode negative regulators of Rho GTPases, which are involved in cell migration, proliferation, and differentiation, actin remodeling, and G1 cell cycle progression.
Product Categories/Family for anti-ARHGAP19 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
rho GTPase-activating protein 19 isoform 1
NCBI Official Synonym Full Names
Rho GTPase activating protein 19
NCBI Official Symbol
ARHGAP19
NCBI Protein Information
rho GTPase-activating protein 19
UniProt Protein Name
Rho GTPase-activating protein 19
Protein Family
UniProt Gene Name
ARHGAP19
UniProt Entry Name
RHG19_HUMAN
NCBI Description
Members of the ARHGAP family, such as ARHGAP19, encode negative regulators of Rho GTPases (see RHOA; MIM 165390), which are involved in cell migration, proliferation, and differentiation, actin remodeling, and G1 cell cycle progression (Lv et al., 2007 [PubMed 17454002]).[supplied by OMIM, Mar 2008]
Research Articles on ARHGAP19
Similar Products
Product Notes
The ARHGAP19 arhgap19 (Catalog #AAA3214922) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARHGAP19 antibody - C-terminal region reacts with Cow, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ARHGAP19 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ARHGAP19 arhgap19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QFNKQSLTQT PGREPSTSQV QKRARSRSFS GLIKRKVLGN QMMSEKKKKN. It is sometimes possible for the material contained within the vial of "ARHGAP19, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
