Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ERCC6L Antibody Titration: 0.2-1 ug/mlPositive Control: THP-1 cell lysate)

Rabbit ERCC6L Polyclonal Antibody | anti-ERCC6L antibody

ERCC6L antibody - N-terminal region

Gene Names
ERCC6L; PICH; RAD26L
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ERCC6L; Polyclonal Antibody; ERCC6L antibody - N-terminal region; anti-ERCC6L antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GDLEEAFKLFNLAKDIFPNEKVLSRIQKIQEALEELAEQGDDEFTDVCNS
Sequence Length
1250
Applicable Applications for anti-ERCC6L antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Horse: 86%; Human: 100%; Pig: 86%; Rabbit: 93%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ERCC6L
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ERCC6L Antibody Titration: 0.2-1 ug/mlPositive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-ERCC6L Antibody Titration: 0.2-1 ug/mlPositive Control: THP-1 cell lysate)
Related Product Information for anti-ERCC6L antibody
This is a rabbit polyclonal antibody against ERCC6L. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ERCC6L is a DNA helicase that acts as an essential component of the spindle assembly checkpoint.ERCC6L contributes to the mitotic checkpoint by recruiting MAD2 to kinetochores and monitoring tension on centromeric chromatin. ERCC6L acts as a tension sensor that associates with catenated DNA which is stretched under tension until it is resolved during anaphase.
Product Categories/Family for anti-ERCC6L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
141kDa
NCBI Official Full Name
DNA excision repair protein ERCC-6-like isoform a
NCBI Official Synonym Full Names
ERCC excision repair 6 like, spindle assembly checkpoint helicase
NCBI Official Symbol
ERCC6L
NCBI Official Synonym Symbols
PICH; RAD26L
NCBI Protein Information
DNA excision repair protein ERCC-6-like
UniProt Protein Name
DNA excision repair protein ERCC-6-like
UniProt Gene Name
ERCC6L
UniProt Synonym Gene Names
PICH
UniProt Entry Name
ERC6L_HUMAN

NCBI Description

This gene encodes a member of the SWItch/Sucrose Non-Fermentable (SWI/SNF2) family of proteins, and contains a SNF2-like ATPase domain and a PICH family domain. One distinguishing feature of this SWI/SNF protein family member is that during interphase, the protein is excluded from the nucleus, and only associates with chromatin after the nuclear envelope has broken down. This protein is a DNA translocase that is thought to bind double-stranded DNA that is exposed to stretching forces, such as those exerted by the mitotic spindle. This protein associates with ribosomal DNA and ultra-fine DNA bridges (UFBs), fine structures that connect sister chromatids during anaphase at some sites such as fragile sites, telomeres and centromeres. This gene is required for the faithful segregation of sister chromatids during mitosis, and the ATPase activity of this protein required for the resolution of UFBs before cytokinesis. [provided by RefSeq, May 2017]

Uniprot Description

PICH: DNA helicase that acts as an essential component of the spindle assembly checkpoint. Contributes to the mitotic checkpoint by recruiting MAD2 to kinetochores and monitoring tension on centromeric chromatin. Acts as a tension sensor that associates with catenated DNA which is stretched under tension until it is resolved during anaphase. Interacts with PLK1, which phosphorylates it. Both proteins are mutually dependent on each other for correct subcellular localization. Belongs to the SNF2/RAD54 helicase family.

Protein type: Helicase; EC 3.6.4.12

Chromosomal Location of Human Ortholog: Xq13.1

Cellular Component: nucleoplasm; centrosome; membrane; cytoplasm; plasma membrane; cytosol

Molecular Function: protein binding; DNA binding; helicase activity; ATP binding

Biological Process: mitosis; metabolic process; cell division; mitotic cell cycle

Research Articles on ERCC6L

Similar Products

Product Notes

The ERCC6L ercc6l (Catalog #AAA3213122) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ERCC6L antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ERCC6L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ERCC6L ercc6l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GDLEEAFKLF NLAKDIFPNE KVLSRIQKIQ EALEELAEQG DDEFTDVCNS. It is sometimes possible for the material contained within the vial of "ERCC6L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.