Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ERCC4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysateERCC4 is supported by BioGPS gene expression data to be expressed in PANC1)

Rabbit ERCC4 Polyclonal Antibody | anti-ERCC4 antibody

ERCC4 antibody - middle region

Gene Names
ERCC4; XPF; RAD1; FANCQ; XFEPS; ERCC11
Reactivity
Dog, Horse, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ERCC4; Polyclonal Antibody; ERCC4 antibody - middle region; anti-ERCC4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FLLRLYRKTFEKDSKAEEVWMKFRKEDSSKRIRKSHKRPKDPQNKERAST
Sequence Length
916
Applicable Applications for anti-ERCC4 antibody
Western Blot (WB)
Homology
Dog: 83%; Horse: 85%; Human: 100%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ERCC4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ERCC4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysateERCC4 is supported by BioGPS gene expression data to be expressed in PANC1)

Western Blot (WB) (WB Suggested Anti-ERCC4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysateERCC4 is supported by BioGPS gene expression data to be expressed in PANC1)
Related Product Information for anti-ERCC4 antibody
This is a rabbit polyclonal antibody against ERCC4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene forms a complex with ERCC1 and is involved in the 5' incision made during nucleotide excision repair. This complex is a structure specific DNA repair endonuclease that interacts with EME1. Defects in this gene are a cause

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
101kDa
NCBI Official Full Name
DNA repair endonuclease XPF
NCBI Official Synonym Full Names
ERCC excision repair 4, endonuclease catalytic subunit
NCBI Official Symbol
ERCC4
NCBI Official Synonym Symbols
XPF; RAD1; FANCQ; XFEPS; ERCC11
NCBI Protein Information
DNA repair endonuclease XPF
UniProt Protein Name
DNA repair endonuclease XPF
UniProt Gene Name
ERCC4
UniProt Synonym Gene Names
ERCC11; XPF
UniProt Entry Name
XPF_HUMAN

NCBI Description

The protein encoded by this gene forms a complex with ERCC1 and is involved in the 5' incision made during nucleotide excision repair. This complex is a structure specific DNA repair endonuclease that interacts with EME1. Defects in this gene are a cause of xeroderma pigmentosum complementation group F (XP-F), or xeroderma pigmentosum VI (XP6).[provided by RefSeq, Mar 2009]

Uniprot Description

ERCC4: Structure-specific DNA repair endonuclease responsible for the 5-prime incision during DNA repair. Involved in homologous recombination that assists in removing interstrand cross-link. Defects in ERCC4 are the cause of xeroderma pigmentosum complementation group F (XP-F); also known as xeroderma pigmentosum VI (XP6). XP-F is an autosomal recessive disease characterized by hypersensitivity of the skin to sunlight followed by high incidence of skin cancer and frequent neurologic abnormalities. Defects in ERCC4 are a cause of XFE progeroid syndrome (XFEPS). This syndrome is illustrated by one patient who presented with dwarfism, cachexia and microcephaly. Belongs to the XPF family.

Protein type: DNA repair, damage; Deoxyribonuclease; EC 3.1.-.-

Chromosomal Location of Human Ortholog: 16p13.12

Cellular Component: nucleoplasm; chromosome, telomeric region; nucleotide-excision repair complex; transcription factor TFIID complex; nuclear chromosome, telomeric region; nucleus

Molecular Function: protein C-terminus binding; protein binding; structure-specific DNA binding; single-stranded DNA specific endodeoxyribonuclease activity; damaged DNA binding; protein N-terminus binding; single-stranded DNA binding; endodeoxyribonuclease activity

Biological Process: nucleotide-excision repair, DNA incision; DNA repair; DNA catabolic process, endonucleolytic; double-strand break repair via homologous recombination; negative regulation of telomere maintenance; nucleotide-excision repair, DNA incision, 3'-to lesion; UV protection; nucleotide-excision repair; transcription-coupled nucleotide-excision repair; resolution of meiotic joint molecules as recombinants; nucleotide-excision repair, DNA damage removal; telomere maintenance; nucleotide-excision repair, DNA incision, 5'-to lesion; response to UV

Disease: Fanconi Anemia, Complementation Group Q; Xeroderma Pigmentosum, Complementation Group F; Xfe Progeroid Syndrome; Tracheoesophageal Fistula With Or Without Esophageal Atresia

Research Articles on ERCC4

Similar Products

Product Notes

The ERCC4 ercc4 (Catalog #AAA3213818) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ERCC4 antibody - middle region reacts with Dog, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ERCC4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ERCC4 ercc4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FLLRLYRKTF EKDSKAEEVW MKFRKEDSSK RIRKSHKRPK DPQNKERAST. It is sometimes possible for the material contained within the vial of "ERCC4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.