Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ERCC2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

Rabbit ERCC2 Polyclonal Antibody | anti-ERCC2 antibody

ERCC2 antibody - N-terminal region

Gene Names
ERCC2; EM9; TTD; XPD; TTD1; COFS2; TFIIH
Reactivity
Cow, Guinea Pig, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ERCC2; Polyclonal Antibody; ERCC2 antibody - N-terminal region; anti-ERCC2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVS
Sequence Length
760
Applicable Applications for anti-ERCC2 antibody
Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ERCC2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ERCC2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-ERCC2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)
Related Product Information for anti-ERCC2 antibody
This is a rabbit polyclonal antibody against ERCC2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The nucleotide excision repair pathway is a mechanism to repair damage to DNA. ERCC2 is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. This protein has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. The nucleotide excision repair pathway is a mechanism to repair damage to DNA. The protein encoded by this gene is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. The gene product has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87kDa
NCBI Official Full Name
general transcription and DNA repair factor IIH helicase subunit XPD isoform 1
NCBI Official Synonym Full Names
ERCC excision repair 2, TFIIH core complex helicase subunit
NCBI Official Symbol
ERCC2
NCBI Official Synonym Symbols
EM9; TTD; XPD; TTD1; COFS2; TFIIH
NCBI Protein Information
general transcription and DNA repair factor IIH helicase subunit XPD
UniProt Protein Name
TFIIH basal transcription factor complex helicase XPD subunit
UniProt Gene Name
ERCC2
UniProt Synonym Gene Names
XPD; XPDC; BTF2 p80; TFIIH 80 kDa subunit; TFIIH p80
UniProt Entry Name
ERCC2_HUMAN

NCBI Description

The nucleotide excision repair pathway is a mechanism to repair damage to DNA. The protein encoded by this gene is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. The gene product has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]

Uniprot Description

ERCC2: ATP-dependent 5'-3' DNA helicase, component of the core- TFIIH basal transcription factor. Involved in nucleotide excision repair (NER) of DNA by opening DNA around the damage, and in RNA transcription by RNA polymerase II by anchoring the CDK-activating kinase (CAK) complex, composed of CDK7, cyclin H and MAT1, to the core-TFIIH complex. Involved in the regulation of vitamin-D receptor activity. Might also have a role in aging process and could play a causative role in the generation of skin cancers. Belongs to the helicase family. RAD3/XPD subfamily. One of the six subunits forming the core-TFIIH basal transcription factor which associates with the CAK complex composed of CDK7, CCNH/cyclin H and MNAT1 to form the TFIIH basal transcription factor. The interaction with GTF2H2 results in the stimulation of the 5'-->3' helicase activity. Interacts with Epstein-Barr virus EBNA2.

Protein type: EC 3.6.4.12; Helicase

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: nucleoplasm; holo TFIIH complex; cytoplasm; spindle; nucleus; cyclin-dependent protein kinase activating kinase holoenzyme complex

Molecular Function: ATP-dependent DNA helicase activity; protein C-terminus binding; RNA polymerase subunit kinase activity; DNA-dependent ATPase activity; protein binding; DNA binding; 4 iron, 4 sulfur cluster binding; metal ion binding; protein N-terminus binding; 5'-3' DNA helicase activity; ATP binding; protein kinase activity

Biological Process: transcription from RNA polymerase II promoter; extracellular matrix organization and biogenesis; erythrocyte maturation; viral reproduction; apoptosis; positive regulation of viral transcription; positive regulation of transcription, DNA-dependent; protein amino acid phosphorylation; regulation of gene expression, epigenetic; bone mineralization; embryonic cleavage; post-embryonic development; chromosome segregation; mRNA capping; UV protection; negative regulation of gene expression, epigenetic; transcription-coupled nucleotide-excision repair; nucleotide-excision repair, DNA damage removal; aging; positive regulation of DNA binding; transcription initiation from RNA polymerase II promoter; in utero embryonic development; multicellular organism growth; nucleotide-excision repair, DNA incision; hair cell differentiation; transcription from RNA polymerase I promoter; RNA elongation from RNA polymerase I promoter; termination of RNA polymerase I transcription; DNA repair; hair follicle maturation; DNA duplex unwinding; cell proliferation; myelin formation in the central nervous system; spinal cord development; nucleotide-excision repair; RNA elongation from RNA polymerase II promoter; response to hypoxia; positive regulation of transcription from RNA polymerase II promoter; gene expression; response to oxidative stress; transcription initiation from RNA polymerase I promoter

Disease: Cerebrooculofacioskeletal Syndrome 2; Xeroderma Pigmentosum, Complementation Group D; Trichothiodystrophy, Photosensitive

Research Articles on ERCC2

Similar Products

Product Notes

The ERCC2 ercc2 (Catalog #AAA3224568) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ERCC2 antibody - N-terminal region reacts with Cow, Guinea Pig, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ERCC2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ERCC2 ercc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KLNVDGLLVY FPYDYIYPEQ FSYMRELKRT LDAKGHGVLE MPSGTGKTVS. It is sometimes possible for the material contained within the vial of "ERCC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.