Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ERCC2 on HeLa cell. [antibody concentration 10 ug/ml])

Mouse ERCC2 Monoclonal Antibody | anti-ERCC2 antibody

ERCC2 (Excision Repair cross-Complementing Rodent Repair Deficiency, Complementation Group 2, COFS2, EM9, MGC102762, MGC126218, MGC126219, TTD, XPD) (APC)

Gene Names
ERCC2; EM9; TTD; XPD; COFS2; TFIIH
Applications
ELISA, Immunofluorescence
Purity
Purified
Synonyms
ERCC2; Monoclonal Antibody; ERCC2 (Excision Repair cross-Complementing Rodent Repair Deficiency; Complementation Group 2; COFS2; EM9; MGC102762; MGC126218; MGC126219; TTD; XPD) (APC); Excision Repair cross-Complementing Rodent Repair Deficiency; XPD; anti-ERCC2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2C9
Specificity
Recognizes ERCC2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-ERCC2 antibody
ELISA (EIA), Immunofluorescence (IF)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ERCC2 (NP_000391, 631aa-730aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RILKARLEYLRDQFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEHLTDANLNLTVDEGVQVAKYFLRQMAQPFHR
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ERCC2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ERCC2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ERCC2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ERCC2 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-ERCC2 antibody
The nucleotide excision repair pathway is a mechanism to repair damage to DNA. The protein encoded by this gene is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. The gene product has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-ERCC2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,274 Da
NCBI Official Full Name
TFIIH basal transcription factor complex helicase XPD subunit isoform 1
NCBI Official Synonym Full Names
excision repair cross-complementation group 2
NCBI Official Symbol
ERCC2
NCBI Official Synonym Symbols
EM9; TTD; XPD; COFS2; TFIIH
NCBI Protein Information
TFIIH basal transcription factor complex helicase XPD subunit; BTF2 p80; CXPD; DNA excision repair protein ERCC-2; DNA repair protein complementing XP-D cells; TFIIH 80 kDa subunit; TFIIH basal transcription factor complex 80 kDa subunit; TFIIH basal tran
UniProt Protein Name
TFIIH basal transcription factor complex helicase XPD subunit
UniProt Gene Name
ERCC2
UniProt Synonym Gene Names
XPD; XPDC; BTF2 p80; TFIIH 80 kDa subunit; TFIIH p80
UniProt Entry Name
ERCC2_HUMAN

Similar Products

Product Notes

The ERCC2 ercc2 (Catalog #AAA6169311) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ERCC2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ERCC2 ercc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ERCC2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.