Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ERCC1Sample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit ERCC1 Polyclonal Antibody | anti-ERCC1 antibody

ERCC1 Antibody - N-terminal region

Gene Names
ERCC1; UV20; COFS4; RAD10
Reactivity
Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ERCC1; Polyclonal Antibody; ERCC1 Antibody - N-terminal region; anti-ERCC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAK
Sequence Length
213
Applicable Applications for anti-ERCC1 antibody
Western Blot (WB)
Homology
Dog: 86%; Guinea Pig: 79%; Human: 100%; Mouse: 85%; Rabbit: 79%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human ERCC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ERCC1Sample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ERCC1Sample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ERCC1 antibody
This is a rabbit polyclonal antibody against ERCC1. It was validated on Western Blot

Target Description: The product of this gene functions in the nucleotide excision repair pathway, and is required for the repair of DNA lesions such as those induced by UV light or formed by electrophilic compounds including cisplatin. The encoded protein forms a heterodimer with the XPF endonuclease (also known as ERCC4), and the heterodimeric endonuclease catalyzes the 5' incision in the process of excising the DNA lesion. The heterodimeric endonuclease is also involved in recombinational DNA repair and in the repair of inter-strand crosslinks. Mutations in this gene result in cerebrooculofacioskeletal syndrome, and polymorphisms that alter expression of this gene may play a role in carcinogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. The last exon of this gene overlaps with the CD3e molecule, epsilon associated protein gene on the opposite strand.
Product Categories/Family for anti-ERCC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
DNA excision repair protein ERCC-1 isoform 3
NCBI Official Synonym Full Names
ERCC excision repair 1, endonuclease non-catalytic subunit
NCBI Official Symbol
ERCC1
NCBI Official Synonym Symbols
UV20; COFS4; RAD10
NCBI Protein Information
DNA excision repair protein ERCC-1
UniProt Protein Name
DNA excision repair protein ERCC-1
UniProt Gene Name
ERCC1
UniProt Entry Name
ERCC1_HUMAN

NCBI Description

The product of this gene functions in the nucleotide excision repair pathway, and is required for the repair of DNA lesions such as those induced by UV light or formed by electrophilic compounds including cisplatin. The encoded protein forms a heterodimer with the XPF endonuclease (also known as ERCC4), and the heterodimeric endonuclease catalyzes the 5' incision in the process of excising the DNA lesion. The heterodimeric endonuclease is also involved in recombinational DNA repair and in the repair of inter-strand crosslinks. Mutations in this gene result in cerebrooculofacioskeletal syndrome, and polymorphisms that alter expression of this gene may play a role in carcinogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. The last exon of this gene overlaps with the CD3e molecule, epsilon associated protein gene on the opposite strand. [provided by RefSeq, Oct 2009]

Uniprot Description

Function: Structure-specific DNA repair endonuclease responsible for the 5'-incision during DNA repair.

Subunit structure: Heterodimer composed of ERCC1 and XPF/ERRC4.

Subcellular location: Nucleus.

Involvement in disease: Cerebro-oculo-facio-skeletal syndrome 4 (COFS4) [MIM:610758]: A disorder of prenatal onset characterized by microcephaly, congenital cataracts, facial dysmorphism, neurogenic arthrogryposis, growth failure and severe psychomotor retardation. COFS is considered to be part of the nucleotide-excision repair disorders spectrum that include also xeroderma pigmentosum, trichothiodystrophy and Cockayne syndrome.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.10

Sequence similarities: Belongs to the ERCC1/RAD10/SWI10 family.

Research Articles on ERCC1

Similar Products

Product Notes

The ERCC1 ercc1 (Catalog #AAA3212484) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ERCC1 Antibody - N-terminal region reacts with Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ERCC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ERCC1 ercc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TVDTSAQAAP QTYAEYAISQ PLEGAGATCP TGSEPLAGET PNQALKPGAK. It is sometimes possible for the material contained within the vial of "ERCC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.