Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: EPHX2Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human EPHX2 Polyclonal Antibody | anti-EPHX2 antibody

EPHX2 Antibody - middle region

Gene Names
EPHX2; CEH; SEH; ABHD20
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
EPHX2; Polyclonal Antibody; EPHX2 Antibody - middle region; anti-EPHX2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRT
Sequence Length
489
Applicable Applications for anti-EPHX2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EPHX2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: EPHX2Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: EPHX2Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-EPHX2 antibody
This gene encodes a member of the epoxide hydrolase family. The protein, found in both the cytosol and peroxisomes, binds to specific epoxides and converts them to the corresponding dihydrodiols. Mutations in this gene have been associated with familial hypercholesterolemia. Alternatively spliced transcript variants have been described.
Product Categories/Family for anti-EPHX2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53 kDa
NCBI Official Full Name
bifunctional epoxide hydrolase 2 isoform b
NCBI Official Synonym Full Names
epoxide hydrolase 2
NCBI Official Symbol
EPHX2
NCBI Official Synonym Symbols
CEH; SEH; ABHD20
NCBI Protein Information
bifunctional epoxide hydrolase 2
UniProt Protein Name
Bifunctional epoxide hydrolase 2
UniProt Gene Name
EPHX2
UniProt Synonym Gene Names
CEH; SEH
UniProt Entry Name
HYES_HUMAN

NCBI Description

This gene encodes a member of the epoxide hydrolase family. The protein, found in both the cytosol and peroxisomes, binds to specific epoxides and converts them to the corresponding dihydrodiols. Mutations in this gene have been associated with familial hypercholesterolemia. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2012]

Uniprot Description

EPHX2: Bifunctional enzyme. The C-terminal domain has epoxide hydrolase activity and acts on epoxides (alkene oxides, oxiranes) and arene oxides. Plays a role in xenobiotic metabolism by degrading potentially toxic epoxides. Also determines steady-state levels of physiological mediators. The N-terminal domain has lipid phosphatase activity, with the highest activity towards threo- 9,10-phosphonooxy-hydroxy-octadecanoic acid, followed by erythro- 9,10-phosphonooxy-hydroxy-octadecanoic acid, 12-phosphonooxy- octadec-9Z-enoic acid, 12-phosphonooxy-octadec-9E-enoic acid, and p-nitrophenyl phospate. Belongs to the AB hydrolase superfamily. Epoxide hydrolase family.

Protein type: Lipid Metabolism - arachidonic acid; EC 3.1.3.76; EC 3.3.2.10; Hydrolase

Chromosomal Location of Human Ortholog: 8p21

Cellular Component: cytoplasm; peroxisome; cytosol

Molecular Function: toxin binding; protein homodimerization activity; lipid-phosphate phosphatase activity; epoxide hydrolase activity; phosphoric monoester hydrolase activity; magnesium ion binding; lipid phosphatase activity; receptor binding

Biological Process: response to toxin; epoxygenase P450 pathway; stilbene catabolic process; positive regulation of vasodilation; phospholipid dephosphorylation; cellular calcium ion homeostasis; cholesterol homeostasis; dephosphorylation; regulation of blood pressure; xenobiotic metabolic process; arachidonic acid metabolic process; drug metabolic process; inflammatory response

Disease: Hypercholesterolemia, Familial

Research Articles on EPHX2

Similar Products

Product Notes

The EPHX2 ephx2 (Catalog #AAA3221617) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EPHX2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EPHX2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EPHX2 ephx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VASLNTPFIP ANPNMSPLES IKANPVFDYQ LYFQEPGVAE AELEQNLSRT. It is sometimes possible for the material contained within the vial of "EPHX2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.