Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Eph Receptor A5 antibody (MBS5301842) used at 1 ug/ml to detect target protein.)

Rabbit Eph Receptor A5 Polyclonal Antibody | anti-Eph Receptor A5 antibody

Eph Receptor A5 antibody

Gene Names
EPHA5; EK7; CEK7; EHK1; HEK7; EHK-1; TYRO4
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
Eph Receptor A5; Polyclonal Antibody; Eph Receptor A5 antibody; Polyclonal Eph Receptor A5; Anti-Eph Receptor A5; EPHA5; EPHA 5; EPHA-5; CEK7; TYRO4; HEK7; EHK1; anti-Eph Receptor A5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
Eph Receptor A5 antibody was raised against the middle region of EPHA5
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EPHA5 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
1037
Applicable Applications for anti-Eph Receptor A5 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
EPHA5 belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Two transcript variants encoding different isoforms have been found for this gene.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
Eph Receptor A5 antibody was raised using the middle region of EPHA5 corresponding to a region with amino acids SDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIP
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Eph Receptor A5 antibody (MBS5301842) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Eph Receptor A5 antibody (MBS5301842) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-Eph Receptor A5 antibody
Rabbit polyclonal Eph Receptor A5 antibody raised against the middle region of EPHA5
Product Categories/Family for anti-Eph Receptor A5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
114 kDa (MW of target protein)
NCBI Official Full Name
ephrin type-A receptor 5 isoform a
NCBI Official Synonym Full Names
EPH receptor A5
NCBI Official Symbol
EPHA5
NCBI Official Synonym Symbols
EK7; CEK7; EHK1; HEK7; EHK-1; TYRO4
NCBI Protein Information
ephrin type-A receptor 5
UniProt Protein Name
Ephrin type-A receptor 5
UniProt Gene Name
EPHA5
UniProt Synonym Gene Names
BSK; EHK1; HEK7; TYRO4; EHK-1; EK7; hEK7
UniProt Entry Name
EPHA5_HUMAN

NCBI Description

This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Aug 2013]

Uniprot Description

EphA5: Receptor tyrosine kinase which binds promiscuously GPI- anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Among GPI-anchored ephrin-A ligands, EFNA5 most probably constitutes the cognate/functional ligand for EPHA5. Functions as an axon guidance molecule during development and may be involved in the development of the retinotectal, entorhino- hippocampal and hippocamposeptal pathways. Together with EFNA5 plays also a role in synaptic plasticity in adult brain through regulation of synaptogenesis. Beside its function in the nervous system, the interaction of EPHA5 with EFNA5 mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion. Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, TK; EC 2.7.10.1; Kinase, protein; Protein kinase, tyrosine (receptor); Membrane protein, integral; TK group; Eph family

Chromosomal Location of Human Ortholog: 4q13.1

Cellular Component: rough endoplasmic reticulum; cell soma; integral to plasma membrane; axon; perinuclear region of cytoplasm; dendrite; plasma membrane; external side of plasma membrane

Molecular Function: transmembrane-ephrin receptor activity; GPI-linked ephrin receptor activity; ephrin receptor activity; ATP binding

Biological Process: axon guidance; cAMP-mediated signaling; peptidyl-tyrosine phosphorylation; regulation of actin cytoskeleton organization and biogenesis; hippocampus development; ephrin receptor signaling pathway; activation of CREB transcription factor; neuron development

Research Articles on Eph Receptor A5

Similar Products

Product Notes

The Eph Receptor A5 epha5 (Catalog #AAA5301842) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Eph Receptor A5 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Eph Receptor A5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the Eph Receptor A5 epha5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Eph Receptor A5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.