Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-EMX1 Polyclonal Antibody)

Rabbit anti-Rat EMX1 Polyclonal Antibody | anti-EMX1 antibody

EMX1 Polyclonal Antibody

Reactivity
Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
EMX1; Polyclonal Antibody; EMX1 Polyclonal Antibody; homeobox protein EMX1; anti-EMX1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.20 mg/ml (varies by lot)
Sequence Length
290
Applicable Applications for anti-EMX1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 70-190 of human EMX1 (NP_004088.2).
Immunogen Sequence
AAAASEEPLRPTALNYPHPSAAEAAFVSGFPAAAAAGAGRSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHRDPLHFYPWVLRNRFFGHRFQASDVPQDGLLLHGPFAR
Positive Samples
Rat Liver
Cellular Location
Cytoplasm, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-EMX1 Polyclonal Antibody)

Western Blot (WB) (Western blot-EMX1 Polyclonal Antibody)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 13kDa; 28kDa
Observed: 35kDa
NCBI Official Full Name
homeobox protein EMX1
NCBI Official Synonym Full Names
empty spiracles homeobox 1
NCBI Official Symbol
EMX1
NCBI Protein Information
homeobox protein EMX1
UniProt Protein Name
Homeobox protein EMX1
Protein Family
UniProt Gene Name
EMX1
UniProt Entry Name
EMX1_HUMAN

Uniprot Description

EMX1: Transcription factor, which in cooperation with EMX2, acts to generate the boundary between the roof and archipallium in the developing brain. May function in combinations with OTX1/2 to specify cell fates in the developing central nervous system. Belongs to the EMX homeobox family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 2p13.2

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; sequence-specific DNA binding

Biological Process: response to drug; regulation of transcription, DNA-dependent; in utero embryonic development; brain morphogenesis; cerebral cortex regionalization; cerebral cortex neuron differentiation; post-embryonic development

Research Articles on EMX1

Similar Products

Product Notes

The EMX1 emx1 (Catalog #AAA9140816) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EMX1 Polyclonal Antibody reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EMX1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the EMX1 emx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EMX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.