Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit anti-Mouse ELOVL5 Polyclonal Antibody | anti-ELOVL5 antibody

ELOVL5 Antibody-middle region

Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ELOVL5; Polyclonal Antibody; ELOVL5 Antibody-middle region; elongation of very long chain fatty acids protein 5; HELO1; AI747313; AU043003; 1110059L23Rik; anti-ELOVL5 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
VFWPCSFPLGWLFFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKGHQ
Applicable Applications for anti-ELOVL5 antibody
Western Blot (WB)
Protein Size
299 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse ELOVL5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ELOVL5Sample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-ELOVL5 antibody
Description of Target: Catalyzes the first and rate-limiting reaction of the four that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. Condensing enzyme that acts specifically toward polyunsaturated acyl-CoA with the higher activity toward C18:3(n-6) acyl-CoA. May participate in the production of monounsaturated and of polyunsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
32kDa
UniProt Protein Name
Elongation of very long chain fatty acids protein 5
UniProt Gene Name
Elovl5
UniProt Synonym Gene Names
ELOVL FA elongase 5
UniProt Entry Name
ELOV5_MOUSE

Similar Products

Product Notes

The ELOVL5 elovl5 (Catalog #AAA3249782) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ELOVL5 Antibody-middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ELOVL5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ELOVL5 elovl5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VFWPCSFPLG WLFFQIGYMI SLIALFTNFY IQTYNKKGAS RRKDHLKGHQ. It is sometimes possible for the material contained within the vial of "ELOVL5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual