Western Blot (WB)
(WB Suggested Anti-ELMOD3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)
Rabbit ELMOD3 Polyclonal Antibody | anti-ELMOD3 antibody
ELMOD3 antibody - C-terminal region
Gene Names
ELMOD3; LST3; RBED1; RBM29; DFNB88
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ELMOD3; Polyclonal Antibody; ELMOD3 antibody - C-terminal region; anti-ELMOD3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FRLSRHHIQQFPFCLMSVNITHIAIQALREECLSRECNRQQKVIPVVNSF
Sequence Length
391
Applicable Applications for anti-ELMOD3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ELMOD3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ELMOD3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)
Western Blot (WB)
(WB Suggested Anti-ELMOD3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)
Related Product Information for anti-ELMOD3 antibody
This is a rabbit polyclonal antibody against ELMOD3. It was validated on Western Blot
Target Description: ELMOD3 lacks GTPase-activating protein (GAP) toward guanine nucleotide exchange factor ARL2.
Target Description: ELMOD3 lacks GTPase-activating protein (GAP) toward guanine nucleotide exchange factor ARL2.
Product Categories/Family for anti-ELMOD3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Synonym Full Names
ELMO domain containing 3
NCBI Official Symbol
ELMOD3
NCBI Official Synonym Symbols
LST3; RBED1; RBM29; DFNB88
NCBI Protein Information
ELMO domain-containing protein 3
UniProt Protein Name
ELMO domain-containing protein 3
Protein Family
UniProt Gene Name
ELMOD3
UniProt Synonym Gene Names
RBED1; RBM29; PP4068
UniProt Entry Name
ELMD3_HUMAN
NCBI Description
This gene encodes a member of the engulfment and cell motility family of GTPase-activating proteins that regulate Arf GTPase proteins. Members of this family are defined by a conserved engulfment and cell motility domain. In rat cochlea, the encoded protein is found in stereocilia, kinocilia and cuticular plate of developing hair cells suggesting a function for this protein in cochlear sensory cells. An allelic variant of this family has been associated with autosomal recessive nonsyndromic deafness-88 in humans. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2016]
Research Articles on ELMOD3
Similar Products
Product Notes
The ELMOD3 elmod3 (Catalog #AAA3214790) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ELMOD3 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ELMOD3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ELMOD3 elmod3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FRLSRHHIQQ FPFCLMSVNI THIAIQALRE ECLSRECNRQ QKVIPVVNSF. It is sometimes possible for the material contained within the vial of "ELMOD3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
