Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ELAC2Sample Type: HepG2 Whole cell lysatesAntibody Dilution: 1.0ug/mlELAC2 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit ELAC2 Polyclonal Antibody | anti-ELAC2 antibody

ELAC2 Antibody - C-terminal region

Gene Names
ELAC2; ELC2; HPC2; COXPD17
Reactivity
Dog, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ELAC2; Polyclonal Antibody; ELAC2 Antibody - C-terminal region; anti-ELAC2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ITCNPEEFIVEALQLPNFQQSVQEYRRSAQDGPAPAEKRSQYPEIIFLGT
Sequence Length
501
Applicable Applications for anti-ELAC2 antibody
Western Blot (WB)
Homology
Dog: 100%; Human: 100%; Mouse: 83%; Rat: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ELAC2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ELAC2Sample Type: HepG2 Whole cell lysatesAntibody Dilution: 1.0ug/mlELAC2 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (Host: RabbitTarget Name: ELAC2Sample Type: HepG2 Whole cell lysatesAntibody Dilution: 1.0ug/mlELAC2 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-ELAC2 antibody
This is a rabbit polyclonal antibody against ELAC2. It was validated on Western Blot

Target Description: The protein encoded by this gene has a C-terminal domain with tRNA 3' processing endoribonuclease activity, which catalyzes the removal of the 3' trailer from precursor tRNAs. The protein also interacts with activated Smad family member 2 (Smad2) and its nuclear partner forkhead box H1 (also known as FAST-1), and reduced expression can suppress transforming growth factor-beta induced growth arrest. Mutations in this gene result in an increased risk of prostate cancer. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-ELAC2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
zinc phosphodiesterase ELAC protein 2 isoform 3
NCBI Official Synonym Full Names
elaC ribonuclease Z 2
NCBI Official Symbol
ELAC2
NCBI Official Synonym Symbols
ELC2; HPC2; COXPD17
NCBI Protein Information
zinc phosphodiesterase ELAC protein 2
UniProt Protein Name
Zinc phosphodiesterase ELAC protein 2
UniProt Gene Name
ELAC2
UniProt Synonym Gene Names
HPC2; RNase Z 2
UniProt Entry Name
RNZ2_HUMAN

NCBI Description

The protein encoded by this gene has a C-terminal domain with tRNA 3′ processing endoribonuclease activity, which catalyzes the removal of the 3' trailer from precursor tRNAs. The protein also interacts with activated Smad family member 2 (Smad2) and its nuclear partner forkhead box H1 (also known as FAST-1), and reduced expression can suppress transforming growth factor-beta induced growth arrest. Mutations in this gene result in an increased risk of prostate cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]

Uniprot Description

ELAC2: a zinc phosphodiesterase. Putative prostate cancer susceptibility protein.

Protein type: Ribonuclease; EC 3.1.26.11; Phosphodiesterase; Oncoprotein; RNA processing

Chromosomal Location of Human Ortholog: 17p11.2

Cellular Component: nucleoplasm; mitochondrion; nucleus

Molecular Function: endonuclease activity; metal ion binding

Disease: Prostate Cancer, Hereditary, 2; Combined Oxidative Phosphorylation Deficiency 17

Research Articles on ELAC2

Similar Products

Product Notes

The ELAC2 elac2 (Catalog #AAA3205789) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ELAC2 Antibody - C-terminal region reacts with Dog, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ELAC2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ELAC2 elac2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ITCNPEEFIV EALQLPNFQQ SVQEYRRSAQ DGPAPAEKRS QYPEIIFLGT. It is sometimes possible for the material contained within the vial of "ELAC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.