Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human EIF5A Polyclonal Antibody | anti-EIF5A antibody

EIF5A (Eukaryotic Translation Initiation Factor 5A-1, eIF-5A-1, eIF-5A1, Eukaryotic Initiation Factor 5A Isoform 1, eIF-5A, eIF-4D, Rev-binding Factor) (MaxLight 550)

Gene Names
EIF5A2; EIF-5A2; eIF5AII
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EIF5A; Polyclonal Antibody; EIF5A (Eukaryotic Translation Initiation Factor 5A-1; eIF-5A-1; eIF-5A1; Eukaryotic Initiation Factor 5A Isoform 1; eIF-5A; eIF-4D; Rev-binding Factor) (MaxLight 550); anti-EIF5A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human EIF5A2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-EIF5A antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human EIF5A2, aa1-153 (NP_065123.1).
Immunogen Sequence
MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK
Conjugate
MaxLight550
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-EIF5A antibody
EIF5A precursor is the only cellular protein known to contain a specific lysine residue which is transformed into the unique amino acid hypusine [N-(4-amino-2-hydroxybutyl)-lysine] by a series of post translational reactions. eIF5A promotes the formation of the first peptide bond during the initial stage of protein synthesis.
Product Categories/Family for anti-EIF5A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,793 Da
NCBI Official Full Name
eukaryotic translation initiation factor 5A-2
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 5A2
NCBI Official Symbol
EIF5A2
NCBI Official Synonym Symbols
EIF-5A2; eIF5AII
NCBI Protein Information
eukaryotic translation initiation factor 5A-2; eIF-5A-2; eukaryotic initiation factor 5A
UniProt Protein Name
Eukaryotic translation initiation factor 5A-2
UniProt Gene Name
EIF5A2
UniProt Synonym Gene Names
eIF-5A-2; eIF-5A2
UniProt Entry Name
IF5A2_HUMAN

Uniprot Description

EIF5A2: mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Functions as a regulator of apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation. Belongs to the eIF-5A family.

Chromosomal Location of Human Ortholog: 3q26.2

Cellular Component: endoplasmic reticulum membrane; nuclear pore; cytosol

Molecular Function: protein binding; ribosome binding; translation elongation factor activity

Biological Process: protein transport; mRNA transport; translational frameshifting; cellular protein metabolic process; positive regulation of cell proliferation; positive regulation of translational elongation; spermatogenesis; hypusine biosynthetic process from peptidyl-lysine; polyamine homeostasis; post-translational protein modification; positive regulation of translational termination

Research Articles on EIF5A

Similar Products

Product Notes

The EIF5A eif5a2 (Catalog #AAA6377180) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EIF5A (Eukaryotic Translation Initiation Factor 5A-1, eIF-5A-1, eIF-5A1, Eukaryotic Initiation Factor 5A Isoform 1, eIF-5A, eIF-4D, Rev-binding Factor) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EIF5A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EIF5A eif5a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EIF5A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.