Mouse anti-Human EIF5A Monoclonal Antibody | anti-EIF5A antibody

EIF5A (Eukaryotic Translation Initiation Factor 5A-1, eIF-5A-1, eIF-5A1, Eukaryotic Initiation Factor 5A Isoform 1, eIF-5A, eIF-4D, Rev-binding Factor) (PE)

Cat. Num. AAA6157613

• Gene Names: EIF5A2; EIF-5A2; eIF5AII
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: EIF5A; Monoclonal Antibody; EIF5A (Eukaryotic Translation Initiation Factor 5A-1; eIF-5A-1; eIF-5A1; Eukaryotic Initiation Factor 5A Isoform 1; eIF-5A; eIF-4D; Rev-binding Factor) (PE); anti-EIF5A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1E7
• Specificity: Recognizes human EIF5A2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-EIF5A antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa66-154 from human EIF5A2 (NP_065123) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.79kD).)

Western Blot (WB)

(Western Blot analysis of EIF5A2 expression in transfected 293T cell line by EIF5A2 monoclonal antibody. Lane 1: EIF5A2 transfected lysate (16.8kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged EIF5A2 is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-EIF5A antibody

EIF5A precursor is the only cellular protein known to contain a specific lysine residue which is transformed into the unique amino acid hypusine [N-(4-amino-2-hydroxybutyl)-lysine] by a series of post translational reactions. eIF5A promotes the formation of the first peptide bond during the initial stage of protein synthesis.

Product Categories/Family for anti-EIF5A antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 9966867
• NCBI GeneID: 56648
• NCBI Accession #: NP_065123
• NCBI GenBank Nucleotide #: NM_020390
• UniProt Accession #: Q9GZV4; B2R4V5
• Molecular Weight: 18.9 kDa (173aa), confirmed by MALDI-TOF
• NCBI Official Full Name: eukaryotic translation initiation factor 5A-2
• NCBI Official Synonym Full Names: eukaryotic translation initiation factor 5A2
• NCBI Official Symbol: EIF5A2
• NCBI Official Synonym Symbols: EIF-5A2; eIF5AII
• NCBI Protein Information: eukaryotic translation initiation factor 5A-2
• UniProt Protein Name: Eukaryotic translation initiation factor 5A-2
• Protein Family: Translation initiation factor
• UniProt Gene Name: EIF5A2
• UniProt Synonym Gene Names: eIF-5A-2; eIF-5A2
• UniProt Entry Name: IF5A2_HUMAN

Uniprot Description

EIF5A2: mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Functions as a regulator of apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation. Belongs to the eIF-5A family.

Chromosomal Location of Human Ortholog: 3q26.2

Cellular Component: endoplasmic reticulum membrane; nuclear pore; cytosol

Molecular Function: protein binding; ribosome binding; translation elongation factor activity

Biological Process: protein transport; mRNA transport; translational frameshifting; cellular protein metabolic process; positive regulation of cell proliferation; positive regulation of translational elongation; spermatogenesis; hypusine biosynthetic process from peptidyl-lysine; polyamine homeostasis; post-translational protein modification; positive regulation of translational termination