Western Blot (WB)
(Host: RabbitTarget Name: EIF4G2Sample Tissue: Mouse Pancreas lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse EIF4G2 Polyclonal Antibody | anti-EIF4G2 antibody
EIF4G2 Antibody-N-terminal region
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EIF4G2; Polyclonal Antibody; EIF4G2 Antibody-N-terminal region; eukaryotic translation initiation factor 4 gamma 2; p97; Nat1; DAP-5; Natm1; E130105L11Rik; anti-EIF4G2 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
GQNAQKWIPARSTRRDDNSAANNSANEKERHDAIFRKVRGILNKLTPEKF
Applicable Applications for anti-EIF4G2 antibody
Western Blot (WB)
Protein Size
906 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse EIF4G2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: EIF4G2Sample Tissue: Mouse Pancreas lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: EIF4G2Sample Tissue: Mouse Pancreas lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-EIF4G2 antibody
Description of Target: Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by this gene shares similarity with the C-terminal region of eIF4G, that contains the binding sites for eIF4A and eIF3; eIF4G in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G which supports cap-dependent and independent translation, this gene product functions as a general repressor of translation by forming translationally inactive complexes. Transgene expression of the apolipoprotein B mRNA-editing enzyme (APOBEC-1) causes extensive editing of this mRNA, which could contribute to the potent oncogenesis induced by overexpression of APOBEC-1. In vitro and in vivo studies in human indicate that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. This also appears to be true for mouse. Two alternatively spliced transcript variants that encode different isoforms have been found for this gene.
NCBI and Uniprot Product Information
NCBI GeneID
UniProt Accession #
Molecular Weight
99kDa
UniProt Protein Name
Eukaryotic translation initiation factor 4 gamma 2
Protein Family
UniProt Gene Name
Eif4g2
UniProt Synonym Gene Names
eIF-4-gamma 2; eIF-4G 2; eIF4G 2
Uniprot Description
Appears to play a role in the switch from cap-dependent to IRES-mediated translation during mitosis, apoptosis and viral infection. Cleaved by some caspases and viral proteases.
Similar Products
Product Notes
The EIF4G2 eif4g2 (Catalog #AAA3249869) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EIF4G2 Antibody-N-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's EIF4G2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EIF4G2 eif4g2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GQNAQKWIPA RSTRRDDNSA ANNSANEKER HDAIFRKVRG ILNKLTPEKF. It is sometimes possible for the material contained within the vial of "EIF4G2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
