Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (EIF3K antibody - C-terminal region validated by WB using U937 Cell Lysate at 1.0ug/ml.)

Rabbit EIF3K Polyclonal Antibody | anti-EIF3K antibody

EIF3K antibody - C-terminal region

Gene Names
EIF3K; M9; ARG134; PLAC24; PTD001; EIF3S12; HSPC029; MSTP001; PLAC-24; PRO1474; EIF3-p28
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EIF3K; Polyclonal Antibody; EIF3K antibody - C-terminal region; anti-EIF3K antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFD
Sequence Length
218
Applicable Applications for anti-EIF3K antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(EIF3K antibody - C-terminal region validated by WB using U937 Cell Lysate at 1.0ug/ml.)

Western Blot (WB) (EIF3K antibody - C-terminal region validated by WB using U937 Cell Lysate at 1.0ug/ml.)

Western Blot (WB)

(Sample Type: 1. Human NT-2 cells (60ug)2. mouse brain extracts (80ug)Primary antibody dilution: 2ug/mlSecondary antibody: IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary antibody dilution: 1: 20,000Image Submitted by: Yuzhi ChenUniversity of Arkansas for Medical Science)

Western Blot (WB) (Sample Type: 1. Human NT-2 cells (60ug)2. mouse brain extracts (80ug)Primary antibody dilution: 2ug/mlSecondary antibody: IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary antibody dilution: 1: 20,000Image Submitted by: Yuzhi ChenUniversity of Arkansas for Medical Science)
Related Product Information for anti-EIF3K antibody
This is a rabbit polyclonal antibody against EIF3K. It was validated on Western Blot

Target Description: The 700-kD eukaryotic translation initiation factor-3 (eIF3) is the largest eIF and contains at least 12 subunits, including EIF2S12. eIF3 plays an essential role in translation by binding directly to the 40S ribosomal subunit and promoting formation of the 40S preinitiation complex.
Product Categories/Family for anti-EIF3K antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
eukaryotic translation initiation factor 3 subunit K isoform 1
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 3 subunit K
NCBI Official Symbol
EIF3K
NCBI Official Synonym Symbols
M9; ARG134; PLAC24; PTD001; EIF3S12; HSPC029; MSTP001; PLAC-24; PRO1474; EIF3-p28
NCBI Protein Information
eukaryotic translation initiation factor 3 subunit K
UniProt Protein Name
Eukaryotic translation initiation factor 3 subunit K
UniProt Gene Name
EIF3K
UniProt Synonym Gene Names
EIF3S12; eIF3k
UniProt Entry Name
EIF3K_HUMAN

NCBI Description

The 700-kD eukaryotic translation initiation factor-3 (eIF3) is the largest eIF and contains at least 12 subunits, including EIF2S12. eIF3 plays an essential role in translation by binding directly to the 40S ribosomal subunit and promoting formation of the 40S preinitiation complex (Mayeur et al., 2003 [PubMed 14519125]).[supplied by OMIM, Mar 2008]

Uniprot Description

EIF3K: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. Belongs to the eIF-3 subunit K family.

Protein type: Translation initiation; Translation

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: eukaryotic translation initiation factor 3 complex; membrane; cytoplasm; cytosol; nucleus

Molecular Function: protein binding; translation initiation factor activity; ribosome binding

Biological Process: cellular protein metabolic process; translation; translational initiation; gene expression; formation of translation preinitiation complex; regulation of translational initiation

Research Articles on EIF3K

Similar Products

Product Notes

The EIF3K eif3k (Catalog #AAA3215509) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EIF3K antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's EIF3K can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EIF3K eif3k for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AEMLGDLSDS QLKVWMSKYG WSADESGQIF ICSQEESIKP KNIVEKIDFD. It is sometimes possible for the material contained within the vial of "EIF3K, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.