Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: EIF2AK1Sample Type: Human 293TAntibody Dilution: 1.0ug/mlEIF2AK1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Rabbit EIF2AK1 Polyclonal Antibody | anti-EIF2AK1 antibody

EIF2AK1 antibody - N-terminal region

Gene Names
EIF2AK1; HCR; HRI
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
EIF2AK1; Polyclonal Antibody; EIF2AK1 antibody - N-terminal region; anti-EIF2AK1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TCSDEFSSLRLHHNRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALE
Sequence Length
630
Applicable Applications for anti-EIF2AK1 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human EIF2AK1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: EIF2AK1Sample Type: Human 293TAntibody Dilution: 1.0ug/mlEIF2AK1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Western Blot (WB) (Host: RabbitTarget Name: EIF2AK1Sample Type: Human 293TAntibody Dilution: 1.0ug/mlEIF2AK1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Western Blot (WB)

(Host: RabbitTarget Name: EIF2AK1Sample Type: Human HelaAntibody Dilution: 1.0ug/mlEIF2AK1 is strongly supported by BioGPS gene expression data to be expressed in HeLa)

Western Blot (WB) (Host: RabbitTarget Name: EIF2AK1Sample Type: Human HelaAntibody Dilution: 1.0ug/mlEIF2AK1 is strongly supported by BioGPS gene expression data to be expressed in HeLa)

Western Blot (WB)

(WB Suggested Anti-EIF2AK1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Lung)

Western Blot (WB) (WB Suggested Anti-EIF2AK1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Lung)
Related Product Information for anti-EIF2AK1 antibody
This is a rabbit polyclonal antibody against EIF2AK1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: EIF2AK1 acts at the level of translation initiation to downregulate protein synthesis in response to stress. The protein is a kinase that can be inactivated by hemin. Two transcript variants encoding different isoforms have been found for this gene.The HRI gene is localized to 7p22 where its 3' end slightly overlaps the 3' end of the gene JTV1. The two genes are transcribed from opposite strands. Studies in rat and rabbit suggest that the HRI gene product phosphorylates the alpha subunit of eukaryotic initiation factor 2. Its kinase activity is induced by low levels of heme and inhibited by the presence of heme. Sequence Note: The sequence AF181071.1 is a chimeric mRNA clone. Only the heme-regulated initiation factor 2-alpha kinase region was propagated into this RefSeq record.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71kDa
NCBI Official Full Name
eukaryotic translation initiation factor 2-alpha kinase 1 isoform a
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 2 alpha kinase 1
NCBI Official Symbol
EIF2AK1
NCBI Official Synonym Symbols
HCR; HRI
NCBI Protein Information
eukaryotic translation initiation factor 2-alpha kinase 1
UniProt Protein Name
Eukaryotic translation initiation factor 2-alpha kinase 1
UniProt Gene Name
EIF2AK1
UniProt Synonym Gene Names
HRI; KIAA1369; HCR
UniProt Entry Name
E2AK1_HUMAN

NCBI Description

The protein encoded by this gene acts at the level of translation initiation to downregulate protein synthesis in response to stress. The encoded protein is a kinase that can be inactivated by hemin. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]

Uniprot Description

HRI: a protein kinase of the PEK family. Phosphorylates the alpha subunit of eukaryotic initiation factor 2 in response to various stress conditions, inhibiting protein synthesis at the level of initiation. Its kinase activity is induced by low levels of heme and inhibited by the presence of heme. Binding of nitric oxide (NO) to the heme iron in the N-terminal heme-binding domain activates the kinase activity, while binding of carbon monoxide (CO) suppresses kinase activity. Requires association with a multiprotein complex containing Hsp90, CDC37 and PPP5C for maturation and activation by autophosporylation. Two alternatively spliced isoforms have been described.

Protein type: EC 2.7.11.1; Translation; Protein kinase, Other; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; Other group; PEK family

Chromosomal Location of Human Ortholog: 7p22

Cellular Component: cytoplasm

Molecular Function: protein homodimerization activity; heme binding; eukaryotic translation initiation factor 2alpha kinase activity; ATP binding

Biological Process: response to external stimulus; negative regulation of cell proliferation; negative regulation of translational initiation by iron; protoporphyrinogen IX metabolic process; protein amino acid autophosphorylation; response to stress; negative regulation of hemoglobin biosynthetic process

Research Articles on EIF2AK1

Similar Products

Product Notes

The EIF2AK1 eif2ak1 (Catalog #AAA3206357) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EIF2AK1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's EIF2AK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the EIF2AK1 eif2ak1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TCSDEFSSLR LHHNRAITHL MRSAKERVRQ DPCEDISRIQ KIRSREVALE. It is sometimes possible for the material contained within the vial of "EIF2AK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.