Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human EFNA1 Polyclonal Antibody | anti-EFNA1 antibody

EFNA1 (Ephrin-A1, EPH-related Receptor Tyrosine Kinase Ligand 1, LERK-1, Immediate Early Response Protein B61, Tumor Necrosis Factor alpha-induced Protein 4, TNF alpha-induced Protein 4, EPLG1, LERK1, TNFAIP4) (MaxLight 650)

Gene Names
EFNA1; B61; EFL1; ECKLG; EPLG1; LERK1; LERK-1; TNFAIP4
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EFNA1; Polyclonal Antibody; EFNA1 (Ephrin-A1; EPH-related Receptor Tyrosine Kinase Ligand 1; LERK-1; Immediate Early Response Protein B61; Tumor Necrosis Factor alpha-induced Protein 4; TNF alpha-induced Protein 4; EPLG1; LERK1; TNFAIP4) (MaxLight 650); anti-EFNA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human EFNA1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-EFNA1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human EFNA1, aa1-205 (NP_004419.2).
Immunogen Sequence
MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHSAAPRLFPLAWTVLLLPLLLLQTP
Conjugate
MaxLight650
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-EFNA1 antibody
Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. Plays an important role in angiogenesis and tumor neovascularization. The recruitment of VAV2, VAV3 and PI3-kinase p85 subunit by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly. Exerts anti-oncogenic effects in tumor cells through activation and down-regulation of EPHA2. Activates EPHA2 by inducing tyrosine phosphorylation which leads to its internalization and degradation. Acts as a negative regulator in the tumorigenesis of gliomas by down-regulating EPHA2 and FAK. Can evoke collapse of embryonic neuronal growth cone and regulates dendritic spine morphogenesis.
Product Categories/Family for anti-EFNA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,787 Da
NCBI Official Full Name
ephrin-A1 isoform a
NCBI Official Synonym Full Names
ephrin-A1
NCBI Official Symbol
EFNA1
NCBI Official Synonym Symbols
B61; EFL1; ECKLG; EPLG1; LERK1; LERK-1; TNFAIP4
NCBI Protein Information
ephrin-A1; TNF alpha-induced protein 4; ligand of eph-related kinase 1; immediate early response protein B61; eph-related receptor tyrosine kinase ligand 1; tumor necrosis factor alpha-induced protein 4; tumor necrosis factor, alpha-induced protein 4
UniProt Protein Name
Ephrin-A1
Protein Family
UniProt Gene Name
EFNA1
UniProt Synonym Gene Names
EPLG1; LERK1; TNFAIP4; LERK-1
UniProt Entry Name
EFNA1_HUMAN

NCBI Description

This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin which binds to the EPHA2, EPHA4, EPHA5, EPHA6, and EPHA7 receptors. Two transcript variants that encode different isoforms were identified through sequence analysis. [provided by RefSeq, Jul 2008]

Uniprot Description

EFNA1: Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. Plays an important role in angiogenesis and tumor neovascularization. The recruitment of VAV2, VAV3 and PI3-kinase p85 subunit by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly. Exerts anti-oncogenic effects in tumor cells through activation and down-regulation of EPHA2. Activates EPHA2 by inducing tyrosine phosphorylation which leads to its internalization and degradation. Acts as a negative regulator in the tumorigenesis of gliomas by down-regulating EPHA2 and FAK. Can evoke collapse of embryonic neuronal growth cone and regulates dendritic spine morphogenesis. Belongs to the ephrin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; Tumor suppressor; Membrane protein, GPI anchor; Ligand, receptor tyrosine kinase

Chromosomal Location of Human Ortholog: 1q21-q22

Cellular Component: anchored to plasma membrane; integral to plasma membrane; extracellular region; plasma membrane

Molecular Function: protein binding; ephrin receptor binding; receptor binding

Biological Process: axon guidance; cell migration; activation of MAPK activity; notochord formation; negative regulation of transcription from RNA polymerase II promoter; regulation of blood vessel endothelial cell migration; regulation of axonogenesis; regulation of angiogenesis; positive regulation of peptidyl-tyrosine phosphorylation; regulation of cell adhesion mediated by integrin; cell-cell signaling; ephrin receptor signaling pathway; angiogenesis; regulation of peptidyl-tyrosine phosphorylation

Research Articles on EFNA1

Similar Products

Product Notes

The EFNA1 efna1 (Catalog #AAA6377049) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EFNA1 (Ephrin-A1, EPH-related Receptor Tyrosine Kinase Ligand 1, LERK-1, Immediate Early Response Protein B61, Tumor Necrosis Factor alpha-induced Protein 4, TNF alpha-induced Protein 4, EPLG1, LERK1, TNFAIP4) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EFNA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EFNA1 efna1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EFNA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.