Rabbit anti-Human EFNA1 Polyclonal Antibody | anti-EFNA1 antibody

EFNA1 (Ephrin-A1, EPH-related Receptor Tyrosine Kinase Ligand 1, LERK-1, Immediate Early Response Protein B61, Tumor Necrosis Factor alpha-induced Protein 4, TNF alpha-induced Protein 4, EPLG1, LERK1, TNFAIP4) (FITC)

Cat. Num. AAA6377044

• Gene Names: EFNA1; B61; EFL1; ECKLG; EPLG1; LERK1; LERK-1; TNFAIP4
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: EFNA1; Polyclonal Antibody; EFNA1 (Ephrin-A1; EPH-related Receptor Tyrosine Kinase Ligand 1; LERK-1; Immediate Early Response Protein B61; Tumor Necrosis Factor alpha-induced Protein 4; TNF alpha-induced Protein 4; EPLG1; LERK1; TNFAIP4) (FITC); anti-EFNA1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human EFNA1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).

• Applicable Applications for anti-EFNA1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human EFNA1, aa1-205 (NP_004419.2).
• Immunogen Sequence: MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHSAAPRLFPLAWTVLLLPLLLLQTP
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of EFNA1 expression in transfected 293T cell line by EFNA1 polyclonal antibody. Lane 1: EFNA1 transfected lysate (23.8kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-EFNA1 antibody

Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. Plays an important role in angiogenesis and tumor neovascularization. The recruitment of VAV2, VAV3 and PI3-kinase p85 subunit by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly. Exerts anti-oncogenic effects in tumor cells through activation and down-regulation of EPHA2. Activates EPHA2 by inducing tyrosine phosphorylation which leads to its internalization and degradation. Acts as a negative regulator in the tumorigenesis of gliomas by down-regulating EPHA2 and FAK. Can evoke collapse of embryonic neuronal growth cone and regulates dendritic spine morphogenesis.

Product Categories/Family for anti-EFNA1 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 33359682
• NCBI GeneID: 1942
• NCBI Accession #: NP_004419.2
• NCBI GenBank Nucleotide #: NM_004428.2
• UniProt Accession #: P20827; Q5SR60; Q5SR61; Q6I9T9; Q8N578; D3DV86
• Molecular Weight: 23,787 Da
• NCBI Official Full Name: ephrin-A1 isoform a
• NCBI Official Synonym Full Names: ephrin-A1
• NCBI Official Symbol: EFNA1
• NCBI Official Synonym Symbols: B61; EFL1; ECKLG; EPLG1; LERK1; LERK-1; TNFAIP4
• NCBI Protein Information: ephrin-A1; TNF alpha-induced protein 4; ligand of eph-related kinase 1; immediate early response protein B61; eph-related receptor tyrosine kinase ligand 1; tumor necrosis factor alpha-induced protein 4; tumor necrosis factor, alpha-induced protein 4
• UniProt Protein Name: Ephrin-A1
• Protein Family: Ephrin
• UniProt Gene Name: EFNA1
• UniProt Synonym Gene Names: EPLG1; LERK1; TNFAIP4; LERK-1
• UniProt Entry Name: EFNA1_HUMAN

NCBI Description

This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin which binds to the EPHA2, EPHA4, EPHA5, EPHA6, and EPHA7 receptors. Two transcript variants that encode different isoforms were identified through sequence analysis. [provided by RefSeq, Jul 2008]

Uniprot Description

EFNA1: Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. Plays an important role in angiogenesis and tumor neovascularization. The recruitment of VAV2, VAV3 and PI3-kinase p85 subunit by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly. Exerts anti-oncogenic effects in tumor cells through activation and down-regulation of EPHA2. Activates EPHA2 by inducing tyrosine phosphorylation which leads to its internalization and degradation. Acts as a negative regulator in the tumorigenesis of gliomas by down-regulating EPHA2 and FAK. Can evoke collapse of embryonic neuronal growth cone and regulates dendritic spine morphogenesis. Belongs to the ephrin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; Tumor suppressor; Membrane protein, GPI anchor; Ligand, receptor tyrosine kinase

Chromosomal Location of Human Ortholog: 1q21-q22

Cellular Component: anchored to plasma membrane; integral to plasma membrane; extracellular region; plasma membrane

Molecular Function: protein binding; ephrin receptor binding; receptor binding

Biological Process: axon guidance; cell migration; activation of MAPK activity; notochord formation; negative regulation of transcription from RNA polymerase II promoter; regulation of blood vessel endothelial cell migration; regulation of axonogenesis; regulation of angiogenesis; positive regulation of peptidyl-tyrosine phosphorylation; regulation of cell adhesion mediated by integrin; cell-cell signaling; ephrin receptor signaling pathway; angiogenesis; regulation of peptidyl-tyrosine phosphorylation