<
Western Blot (WB)
(Host: MouseTarget Name: EEF1A1Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)
Rabbit EEF1A1 Polyclonal Antibody | anti-EEF1A1 antibody
EEF1A1 antibody - C-terminal region
Gene Names
EEF1A1; CCS3; EF1A; PTI1; CCS-3; EE1A1; EEF-1; EEF1A; EF-Tu; LENG7; eEF1A-1; GRAF-1EF; HNGC:16303
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Protein A purified
Synonyms
EEF1A1; Polyclonal Antibody; EEF1A1 antibody - C-terminal region; anti-EEF1A1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGK
Sequence Length
462
Applicable Applications for anti-EEF1A1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human EEF1A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: MouseTarget Name: EEF1A1Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: MouseTarget Name: EEF1A1Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)
Western Blot (WB)
(WB Suggested Anti-EEF1A1 antibody Titration: 1 ug/mLSample Type: Human Hela)
Western Blot (WB)
(WB Suggested Anti-EEF1A1 antibody Titration: 1 ug/mLSample Type: Human Hela)
Western Blot (WB)
(WB Suggested Anti-EEF1A1 antibody Titration: 1 ug/mLSample Type: Human HepG2)
Western Blot (WB)
(WB Suggested Anti-EEF1A1 antibody Titration: 1 ug/mLSample Type: Human HepG2)
Western Blot (WB)
(WB Suggested Anti-EEF1A1 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysateEEF1A1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)
Western Blot (WB)
(WB Suggested Anti-EEF1A1 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysateEEF1A1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)
Related Product Information for anti-EEF1A1 antibody
This is a rabbit polyclonal antibody against EEF1A1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: EEF1A1 is an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome.This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome. This gene has been found to have multiple copies on many chromosomes, some of which, if not all, represent different pseudogenes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Target Description: EEF1A1 is an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome.This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome. This gene has been found to have multiple copies on many chromosomes, some of which, if not all, represent different pseudogenes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-EEF1A1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
elongation factor 1-alpha 1
NCBI Official Synonym Full Names
eukaryotic translation elongation factor 1 alpha 1
NCBI Official Symbol
EEF1A1
NCBI Official Synonym Symbols
CCS3; EF1A; PTI1; CCS-3; EE1A1; EEF-1; EEF1A; EF-Tu; LENG7; eEF1A-1; GRAF-1EF; HNGC:16303
NCBI Protein Information
elongation factor 1-alpha 1
UniProt Protein Name
Elongation factor 1-alpha 1
UniProt Gene Name
EEF1A1
UniProt Synonym Gene Names
EEF1A; EF1A; LENG7; EF-1-alpha-1; EF-Tu; eEF1A-1
UniProt Entry Name
EF1A1_HUMAN
NCBI Description
This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome. This gene has been found to have multiple copies on many chromosomes, some of which, if not all, represent different pseudogenes. [provided by RefSeq, Jul 2008]
Research Articles on EEF1A1
Similar Products
Product Notes
The EEF1A1 eef1a1 (Catalog #AAA3208889) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EEF1A1 antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's EEF1A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EEF1A1 eef1a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IVDMVPGKPM CVESFSDYPP LGRFAVRDMR QTVAVGVIKA VDKKAAGAGK. It is sometimes possible for the material contained within the vial of "EEF1A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
