Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (EDG1 rabbit polyclonal antibody. Western Blot analysis of EDG1 expression in mouse lung.)

Rabbit anti-Human, Mouse EDG1 Polyclonal Antibody | anti-EDG1 antibody

EDG1 (Sphingosine 1-phosphate Receptor 1, S1P Receptor 1, S1P1, Endothelial Differentiation G-protein Coupled Receptor 1, Sphingosine 1-phosphate Receptor Edg-1, S1P Receptor Edg-1, CD363, CHEDG1) APC

Gene Names
S1PR1; EDG1; S1P1; CD363; ECGF1; EDG-1; CHEDG1; D1S3362
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EDG1; Polyclonal Antibody; EDG1 (Sphingosine 1-phosphate Receptor 1; S1P Receptor 1; S1P1; Endothelial Differentiation G-protein Coupled Receptor 1; Sphingosine 1-phosphate Receptor Edg-1; S1P Receptor Edg-1; CD363; CHEDG1) APC; anti-EDG1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human EDG1. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-EDG1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human EDG1, aa1-382 (NP_001391.2).
Immunogen Sequence
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(EDG1 rabbit polyclonal antibody. Western Blot analysis of EDG1 expression in mouse lung.)

Western Blot (WB) (EDG1 rabbit polyclonal antibody. Western Blot analysis of EDG1 expression in mouse lung.)

Western Blot (WB)

(Western Blot analysis of S1PR1 expression in transfected 293T cell line by S1PR1 polyclonal antibody. Lane 1: EDG1 transfected lysate (42.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of S1PR1 expression in transfected 293T cell line by S1PR1 polyclonal antibody. Lane 1: EDG1 transfected lysate (42.8kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-EDG1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,811 Da
NCBI Official Full Name
sphingosine 1-phosphate receptor 1
NCBI Official Synonym Full Names
sphingosine-1-phosphate receptor 1
NCBI Official Symbol
S1PR1
NCBI Official Synonym Symbols
EDG1; S1P1; CD363; ECGF1; EDG-1; CHEDG1; D1S3362
NCBI Protein Information
sphingosine 1-phosphate receptor 1; S1P receptor 1; S1P receptor Edg-1; sphingosine 1-phosphate receptor EDG1; sphingosine 1-phosphate receptor Edg-1; endothelial differentiation G-protein coupled receptor 1; endothelial differentiation, sphingolipid G-pr
UniProt Protein Name
Sphingosine 1-phosphate receptor 1
UniProt Gene Name
S1PR1
UniProt Synonym Gene Names
CHEDG1; EDG1; S1P receptor 1; S1P1
UniProt Entry Name
S1PR1_HUMAN

NCBI Description

The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the processes that regulate the differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion. [provided by RefSeq, Jul 2008]

Uniprot Description

EDG-1: a G protein-coupled receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. Highly expressed in endothelial cells and to a lesser extent, in vascular smooth muscle cells, fibroblasts, melanocytes, and cells of epithelioid origin. Suggested to be involved in the processes that regulate the migration/differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion. S1P-induced endothelial cell migration requires AKT1-mediated phosphorylation of the third intracellular loop. Seems to be coupled to the G(i) subclass of heteromeric G proteins.

Protein type: Receptor, GPCR; GPCR, family 1; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 1p21

Cellular Component: plasma membrane; integral to membrane; intrinsic to plasma membrane; endosome; external side of plasma membrane; lipid raft

Molecular Function: G-protein coupled receptor activity; sphingolipid binding; G-protein-coupled receptor binding

Biological Process: lamellipodium biogenesis; regulation of cell adhesion; endothelial cell differentiation; regulation of bone resorption; elevation of cytosolic calcium ion concentration during G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); cell migration; negative regulation of stress fiber formation; positive regulation of positive chemotaxis; positive regulation of smooth muscle cell proliferation; transmission of nerve impulse; chemotaxis; blood vessel maturation; neuron differentiation; G-protein coupled receptor protein signaling pathway; actin cytoskeleton reorganization; positive regulation of transcription from RNA polymerase II promoter; G-protein signaling, adenylate cyclase inhibiting pathway; brain development; angiogenesis; cell adhesion; regulation of bone mineralization; positive regulation of cell migration

Research Articles on EDG1

Similar Products

Product Notes

The EDG1 s1pr1 (Catalog #AAA6376965) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EDG1 (Sphingosine 1-phosphate Receptor 1, S1P Receptor 1, S1P1, Endothelial Differentiation G-protein Coupled Receptor 1, Sphingosine 1-phosphate Receptor Edg-1, S1P Receptor Edg-1, CD363, CHEDG1) APC reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's EDG1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EDG1 s1pr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EDG1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.