Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human NLRP3 Monoclonal Antibody | anti-NLRP3 antibody

NLRP3 (NACHT, LRR and PYD Domains-containing Protein 3, Angiotensin/Vasopressin Receptor AII/AVP-like, Caterpiller Protein 1.1, CLR1.1, Cold Autoinflammatory Syndrome 1 Protein, Cryopyrin, PYRIN-containing APAF1-like Protein 1, C1orf7, CIAS1, NALP3, PYPAF

Gene Names
NLRP3; AII; AVP; FCU; MWS; FCAS; KEFH; CIAS1; FCAS1; NALP3; C1orf7; CLR1.1; DFNA34; PYPAF1; AGTAVPRL
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NLRP3; Monoclonal Antibody; NLRP3 (NACHT; LRR and PYD Domains-containing Protein 3; Angiotensin/Vasopressin Receptor AII/AVP-like; Caterpiller Protein 1.1; CLR1.1; Cold Autoinflammatory Syndrome 1 Protein; Cryopyrin; PYRIN-containing APAF1-like Protein 1; C1orf7; CIAS1; NALP3; PYPAF; anti-NLRP3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B1
Specificity
Recognizes human CIAS1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-NLRP3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101 from human CIAS1 (NP_004886) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKMASTRCKLARYLEDLEDVDLKKFKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDNAR
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of CIAS1 expression in transfected 293T cell line by CIAS1 monoclonal antibody. Lane 1: CIAS1 transfected lysate (118.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CIAS1 expression in transfected 293T cell line by CIAS1 monoclonal antibody. Lane 1: CIAS1 transfected lysate (118.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-NLRP3 antibody
May function as an inducer of apoptosis. Interacts selectively with ASC and this complex may function as an upstream activator of NF-kappa-B signaling. Inhibits TNF-alpha induced activation and nuclear translocation of RELA/NF-KB p65. Also inhibits transcriptional activity of RELA. Activates caspase-1 in response to a number of triggers including bacterial or viral infection which leads to processing and release of IL1B and IL18.
Product Categories/Family for anti-NLRP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
114kDa
NCBI Official Full Name
NACHT, LRR and PYD domains-containing protein 3 isoform a
NCBI Official Synonym Full Names
NLR family pyrin domain containing 3
NCBI Official Symbol
NLRP3
NCBI Official Synonym Symbols
AII; AVP; FCU; MWS; FCAS; KEFH; CIAS1; FCAS1; NALP3; C1orf7; CLR1.1; DFNA34; PYPAF1; AGTAVPRL
NCBI Protein Information
NACHT, LRR and PYD domains-containing protein 3
UniProt Protein Name
NACHT, LRR and PYD domains-containing protein 3
UniProt Gene Name
NLRP3
UniProt Synonym Gene Names
C1orf7; CIAS1; NALP3; PYPAF1; CLR1.1
UniProt Entry Name
NALP3_HUMAN

NCBI Description

This gene encodes a pyrin-like protein containing a pyrin domain, a nucleotide-binding site (NBS) domain, and a leucine-rich repeat (LRR) motif. This protein interacts with the apoptosis-associated speck-like protein PYCARD/ASC, which contains a caspase recruitment domain, and is a member of the NALP3 inflammasome complex. This complex functions as an upstream activator of NF-kappaB signaling, and it plays a role in the regulation of inflammation, the immune response, and apoptosis. Mutations in this gene are associated with familial cold autoinflammatory syndrome (FCAS), Muckle-Wells syndrome (MWS), chronic infantile neurological cutaneous and articular (CINCA) syndrome, and neonatal-onset multisystem inflammatory disease (NOMID). Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. Alternative 5' UTR structures are suggested by available data; however, insufficient evidence is available to determine if all of the represented 5' UTR splice patterns are biologically valid. [provided by RefSeq, Oct 2008]

Uniprot Description

NLRP3: May function as an inducer of apoptosis. Interacts selectively with ASC and this complex may function as an upstream activator of NF-kappa-B signaling. Inhibits TNF-alpha induced activation and nuclear translocation of RELA/NF-KB p65. Also inhibits transcriptional activity of RELA. Activates caspase-1 in response to a number of triggers including bacterial or viral infection which leads to processing and release of IL1B and IL18. Defects in NLRP3 are the cause of familial cold autoinflammatory syndrome type 1 (FCAS1); also known as familial cold urticaria. FCAS are rare autosomal dominant systemic inflammatory diseases characterized by episodes of rash, arthralgia, fever and conjunctivitis after generalized exposure to cold. Defects in NLRP3 are a cause of Muckle-Wells syndrome (MWS); also known as urticaria-deafness-amyloidosis syndrome. MWS is a hereditary periodic fever syndrome characterized by fever, chronic recurrent urticaria, arthralgias, progressive sensorineural deafness, and reactive renal amyloidosis. The disease may be severe if generalized amyloidosis occurs. Defects in NLRP3 are the cause of chronic infantile neurologic cutaneous and articular syndrome (CINCA); also known as neonatal onset multisystem inflammatory disease (NOMID). CINCA is a rare congenital inflammatory disorder characterized by a triad of neonatal onset of cutaneous symptoms, chronic meningitis and joint manifestations with recurrent fever and inflammation. Belongs to the NLRP family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Inhibitor

Chromosomal Location of Human Ortholog: 1q44

Cellular Component: cytoplasm; cytosol

Molecular Function: protein binding; peptidoglycan binding; ATP binding

Biological Process: caspase activation; apoptosis; negative regulation of acute inflammatory response; positive regulation of caspase activity; interleukin-1 beta production; defense response; negative regulation of NF-kappaB import into nucleus; positive regulation of interleukin-1 beta secretion; signal transduction; protein oligomerization; activation of NF-kappaB transcription factor; negative regulation of interleukin-1 beta secretion; inhibition of NF-kappaB transcription factor; negative regulation of inflammatory response; interleukin-18 production; innate immune response; interleukin-1 secretion; inflammatory response; detection of biotic stimulus; defense response to virus

Disease: Cinca Syndrome; Familial Cold Autoinflammatory Syndrome 1; Muckle-wells Syndrome

Research Articles on NLRP3

Similar Products

Product Notes

The NLRP3 nlrp3 (Catalog #AAA6153809) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NLRP3 (NACHT, LRR and PYD Domains-containing Protein 3, Angiotensin/Vasopressin Receptor AII/AVP-like, Caterpiller Protein 1.1, CLR1.1, Cold Autoinflammatory Syndrome 1 Protein, Cryopyrin, PYRIN-containing APAF1-like Protein 1, C1orf7, CIAS1, NALP3, PYPAF reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NLRP3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NLRP3 nlrp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NLRP3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.