Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (EDEM1 antibody (MBS839110) used at 1 ug/ml to detect target protein.)

Rabbit anti-Human, Mouse EDEM1 Polyclonal Antibody | anti-EDEM1 antibody

EDEM1 antibody

Gene Names
EDEM1; EDEM
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
EDEM1; Polyclonal Antibody; EDEM1 antibody; Polyclonal EDEM1; Anti-EDEM1; EDEM; KIAA0212; Er Degradation Enhancer Mannosidase Alpha-Like 1; anti-EDEM1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Specificity
EDEM1 antibody was raised against the N terminal of EDEM1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EDEM1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
657
Applicable Applications for anti-EDEM1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
EDEM1 belongs to the glycosyl hydrolase 47 family. It extracts misfolded glycoproteins, but not glycoproteins undergoing productive folding, from the calnexin cycle. It is directly involved in endoplasmic reticulum-associated degradation (ERAD) and targets misfolded glycoproteins for degradation in an N-glycan-dependent manner.
Cross-Reactivity
Human,Mouse
Immunogen
EDEM1 antibody was raised using the N terminal of EDEM1 corresponding to a region with amino acids MAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAI
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(EDEM1 antibody (MBS839110) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (EDEM1 antibody (MBS839110) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-EDEM1 antibody
Rabbit polyclonal EDEM1 antibody raised against the N terminal of EDEM1
Product Categories/Family for anti-EDEM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
74 kDa (MW of target protein)
NCBI Official Full Name
ER degradation-enhancing alpha-mannosidase-like protein 1
NCBI Official Synonym Full Names
ER degradation enhancer, mannosidase alpha-like 1
NCBI Official Symbol
EDEM1
NCBI Official Synonym Symbols
EDEM
NCBI Protein Information
ER degradation-enhancing alpha-mannosidase-like protein 1
UniProt Protein Name
ER degradation-enhancing alpha-mannosidase-like protein 1
UniProt Gene Name
EDEM1
UniProt Synonym Gene Names
EDEM; KIAA0212
UniProt Entry Name
EDEM1_HUMAN

Uniprot Description

EDEM1: Extracts misfolded glycoproteins, but not glycoproteins undergoing productive folding, from the calnexin cycle. It is directly involved in endoplasmic reticulum-associated degradation (ERAD) and targets misfolded glycoproteins for degradation in an N-glycan-independent manner, probably by forming a complex with SEL1L. It lacks mannosidase activity. Belongs to the glycosyl hydrolase 47 family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 3p26.1

Cellular Component: endoplasmic reticulum membrane; integral to endoplasmic reticulum membrane

Molecular Function: protein binding; mannosyl-oligosaccharide 1,2-alpha-mannosidase activity; misfolded protein binding; calcium ion binding

Biological Process: ER-associated protein catabolic process; unfolded protein response, activation of signaling protein activity; cellular protein metabolic process; protein folding; unfolded protein response; protein amino acid N-linked glycosylation via asparagine; post-translational protein modification

Research Articles on EDEM1

Similar Products

Product Notes

The EDEM1 edem1 (Catalog #AAA839110) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EDEM1 antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's EDEM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the EDEM1 edem1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EDEM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.