Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: E2F3Sample Tissue: Human DLD1 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human E2F3 Polyclonal Antibody | anti-E2F3 antibody

E2F3 Antibody - middle region

Gene Names
E2F3; E2F-3
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
E2F3; Polyclonal Antibody; E2F3 Antibody - middle region; anti-E2F3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: STQGPIEVYLCPEETETHSPMKTNNQDHNGNIPKPASKDLASTNSGHSDC
Sequence Length
167
Applicable Applications for anti-E2F3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human E2F3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: E2F3Sample Tissue: Human DLD1 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: E2F3Sample Tissue: Human DLD1 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-E2F3 antibody
This gene encodes a member of a small family of transcription factors that function through binding of DP interaction partner proteins. The encoded protein recognizes a specific sequence motif in DNA and interacts directly with the retinoblastoma protein (pRB) to regulate the expression of genes involved in the cell cycle. Altered copy number and activity of this gene have been observed in a number of human cancers. There are pseudogenes for this gene on chromosomes 2 and 17. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-E2F3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49 kDa
NCBI Official Full Name
transcription factor E2F3 isoform 2
NCBI Official Synonym Full Names
E2F transcription factor 3
NCBI Official Symbol
E2F3
NCBI Official Synonym Symbols
E2F-3
NCBI Protein Information
transcription factor E2F3
UniProt Protein Name
Transcription factor E2F3
Protein Family
UniProt Gene Name
E2F3
UniProt Synonym Gene Names
KIAA0075; E2F-3
UniProt Entry Name
E2F3_HUMAN

NCBI Description

This gene encodes a member of a small family of transcription factors that function through binding of DP interaction partner proteins. The encoded protein recognizes a specific sequence motif in DNA and interacts directly with the retinoblastoma protein (pRB) to regulate the expression of genes involved in the cell cycle. Altered copy number and activity of this gene have been observed in a number of human cancers. There are pseudogenes for this gene on chromosomes 2 and 17. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2013]

Uniprot Description

E2F3: Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC- 3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. E2F3 binds specifically to RB1 in a cell-cycle dependent manner. Belongs to the E2F/DP family.

Protein type: Transcription factor; DNA-binding; Cell cycle regulation

Chromosomal Location of Human Ortholog: 6p22

Cellular Component: nucleoplasm; Golgi apparatus; transcription factor complex; intracellular membrane-bound organelle; cytoplasm; nucleus

Molecular Function: protein binding; transcription factor activity

Biological Process: transcription initiation from RNA polymerase II promoter; Notch signaling pathway; positive regulation of transcription, DNA-dependent; positive regulation of cell proliferation; mitotic cell cycle

Research Articles on E2F3

Similar Products

Product Notes

The E2F3 e2f3 (Catalog #AAA3220236) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The E2F3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's E2F3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the E2F3 e2f3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: STQGPIEVYL CPEETETHSP MKTNNQDHNG NIPKPASKDL ASTNSGHSDC. It is sometimes possible for the material contained within the vial of "E2F3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.