Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of DYNC1H1 expression in transfected 293T cell line by DYNC1H1 polyclonal antibody. Lane 1: DYNC1H1 transfected lysate (22.2kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human DYNC1H1 Polyclonal Antibody | anti-DYNC1H1 antibody

DYNC1H1 (Cytoplasmic Dynein 1 Heavy Chain 1, Cytoplasmic Dynein Heavy Chain 1, Dynein Heavy Chain, Cytosolic, DHC1, DNCH1, DNCL, DNECL, DYHC, KIAA0325) (AP)

Gene Names
DYNC1H1; p22; DHC1; DNCL; DYHC; HL-3; CMT2O; DHC1a; DNCH1; DNECL; Dnchc1; SMALED1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DYNC1H1; Polyclonal Antibody; DYNC1H1 (Cytoplasmic Dynein 1 Heavy Chain 1; Cytoplasmic Dynein Heavy Chain 1; Dynein Heavy Chain; Cytosolic; DHC1; DNCH1; DNCL; DNECL; DYHC; KIAA0325) (AP); anti-DYNC1H1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human DYNC1H1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-DYNC1H1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human DYNC1H1, aa1-197 (AAH64521.1).
Immunogen Sequence
MISKMLKMQMLEDEDDLAYAETEKKTRTDSTSDGRPAWMRTLHTTASNWLHLIPQTLSHLKRTVENIKDPLFRFFEREVKMGAKLLQDVRQDLADVVQVCEGKKKQTNYLRTLINELVKGILPRSWSHYTVPAGMTVIQWVSDFSERIKQLQNISLAAASGGAKELKVKALLTSLGWSAAVLGWGGSGSGEKHRAQV
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of DYNC1H1 expression in transfected 293T cell line by DYNC1H1 polyclonal antibody. Lane 1: DYNC1H1 transfected lysate (22.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DYNC1H1 expression in transfected 293T cell line by DYNC1H1 polyclonal antibody. Lane 1: DYNC1H1 transfected lysate (22.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-DYNC1H1 antibody
Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP.
Product Categories/Family for anti-DYNC1H1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
532,408 Da
NCBI Official Full Name
Homo sapiens dynein, cytoplasmic 1, heavy chain 1, mRNA
NCBI Official Synonym Full Names
dynein cytoplasmic 1 heavy chain 1
NCBI Official Symbol
DYNC1H1
NCBI Official Synonym Symbols
p22; DHC1; DNCL; DYHC; HL-3; CMT2O; DHC1a; DNCH1; DNECL; Dnchc1; SMALED1
NCBI Protein Information
cytoplasmic dynein 1 heavy chain 1
Protein Family

NCBI Description

Dyneins are a group of microtubule-activated ATPases that function as molecular motors. They are divided into two subgroups of axonemal and cytoplasmic dyneins. The cytoplasmic dyneins function in intracellular motility, including retrograde axonal transport, protein sorting, organelle movement, and spindle dynamics. Molecules of conventional cytoplasmic dynein are comprised of 2 heavy chain polypeptides and a number of intermediate and light chains.This gene encodes a member of the cytoplasmic dynein heavy chain family. [provided by RefSeq, Oct 2008]

Research Articles on DYNC1H1

Similar Products

Product Notes

The DYNC1H1 (Catalog #AAA6376788) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DYNC1H1 (Cytoplasmic Dynein 1 Heavy Chain 1, Cytoplasmic Dynein Heavy Chain 1, Dynein Heavy Chain, Cytosolic, DHC1, DNCH1, DNCL, DNECL, DYHC, KIAA0325) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DYNC1H1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DYNC1H1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DYNC1H1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.