Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: Dusp11Sample Type: Mouse Testis lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Dusp11 Polyclonal Antibody | anti-DUSP11 antibody

Dusp11 Antibody - middle region

Gene Names
Dusp11; AI481497; 2010300F21Rik
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Dusp11; Polyclonal Antibody; Dusp11 Antibody - middle region; anti-DUSP11 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AFKVPLQKKFEAKLMPEECFSPLDLFNKIQEQNEELGLIIDLTYTQRYYK
Sequence Length
321
Applicable Applications for anti-DUSP11 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Horse: 79%; Human: 100%; Mouse: 79%; Pig: 86%; Rabbit: 86%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Mouse Dusp11
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: Dusp11Sample Type: Mouse Testis lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: Dusp11Sample Type: Mouse Testis lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-DUSP11 antibody
This is a rabbit polyclonal antibody against Dusp11. It was validated on Western Blot

Target Description: It has both, RNA 5'-diphosphatase and 5'-triphosphatase activities, but displays a poor protein-tyrosine phosphatase activity.Dusp11 binds to RNA. Dusp11 may participate in nuclear mRNA metabolism.
Product Categories/Family for anti-DUSP11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
RNA/RNP complex-1-interacting phosphatase
NCBI Official Synonym Full Names
dual specificity phosphatase 11 (RNA/RNP complex 1-interacting)
NCBI Official Symbol
Dusp11
NCBI Official Synonym Symbols
AI481497; 2010300F21Rik
NCBI Protein Information
RNA/RNP complex-1-interacting phosphatase
UniProt Protein Name
RNA/RNP complex-1-interacting phosphatase
UniProt Gene Name
Dusp11
UniProt Synonym Gene Names
Pir1
UniProt Entry Name
DUS11_MOUSE

Uniprot Description

DUSP11: Possesses RNA 5'-triphosphatase and diphosphatase activities, but displays a poor protein-tyrosine phosphatase activity. Binds to RNA. May participate in nuclear mRNA metabolism. Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.3.-; Motility/polarity/chemotaxis; Protein phosphatase, dual-specificity; Phosphatase (non-protein)

Cellular Component: nucleus

Molecular Function: polynucleotide 5'-phosphatase activity; protein tyrosine/threonine phosphatase activity; inositol-1,3,4-trisphosphate 4-phosphatase activity; hydrolase activity; phosphatidylinositol-3,5-bisphosphate 5-phosphatase activity; RNA binding; protein tyrosine phosphatase activity; inositol-1,4,5,6-tetrakisphosphate 6-phosphatase activity; inositol bisphosphate phosphatase activity; inositol-1,3,4,5,6-pentakisphosphate 3-phosphatase activity; JUN kinase phosphatase activity; transmembrane receptor protein phosphatase activity; NADP phosphatase activity; phosphatidylinositol-4-phosphate phosphatase activity; 5-amino-6-(5-phosphoribitylamino)uracil phosphatase activity; protein tyrosine/serine/threonine phosphatase activity; phosphoric monoester hydrolase activity; inositol-4,5-bisphosphate 5-phosphatase activity; MAP kinase tyrosine/serine/threonine phosphatase activity; phosphohistidine phosphatase activity

Biological Process: dephosphorylation; RNA metabolic process; protein amino acid dephosphorylation

Similar Products

Product Notes

The DUSP11 dusp11 (Catalog #AAA3205253) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Dusp11 Antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Dusp11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DUSP11 dusp11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AFKVPLQKKF EAKLMPEECF SPLDLFNKIQ EQNEELGLII DLTYTQRYYK. It is sometimes possible for the material contained within the vial of "Dusp11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.