Western Blot (WB)
(WB Suggested Anti-ATOH7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)
Rabbit ATOH7 Polyclonal Antibody | anti-ATOH7 antibody
ATOH7 antibody - C-terminal region
Gene Names
ATOH7; Math5; NCRNA; RNANC; PHPVAR; bHLHa13
Reactivity
Cow, Dog, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ATOH7; Polyclonal Antibody; ATOH7 antibody - C-terminal region; anti-ATOH7 antibody
Host
Rabbit
Reactivity
Cow, Dog, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLFGFQPEPFQMA
Sequence Length
152
Applicable Applications for anti-ATOH7 antibody
Western Blot (WB)
Homology
Cow: 77%; Dog: 85%; Human: 100%; Pig: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ATOH7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ATOH7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)
Western Blot (WB)
(WB Suggested Anti-ATOH7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)
Related Product Information for anti-ATOH7 antibody
This is a rabbit polyclonal antibody against ATOH7. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ATOH7 is a transcription factor involved in the differentiation of retinal ganglion cells.ATOH7 is a member of the family of basic helix-loop-helix (bHLH) proteins with similarity to Drosophila 'atonal,' a proneural bHLH gene that controls photoreceptor development (Brown et al., 2002 [PubMed 11889557]).[supplied by OMIM].
Target Description: ATOH7 is a transcription factor involved in the differentiation of retinal ganglion cells.ATOH7 is a member of the family of basic helix-loop-helix (bHLH) proteins with similarity to Drosophila 'atonal,' a proneural bHLH gene that controls photoreceptor development (Brown et al., 2002 [PubMed 11889557]).[supplied by OMIM].
Product Categories/Family for anti-ATOH7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
protein atonal homolog 7
NCBI Official Synonym Full Names
atonal bHLH transcription factor 7
NCBI Official Symbol
ATOH7
NCBI Official Synonym Symbols
Math5; NCRNA; RNANC; PHPVAR; bHLHa13
NCBI Protein Information
protein atonal homolog 7
UniProt Protein Name
Protein atonal homolog 7
Protein Family
UniProt Gene Name
ATOH7
UniProt Synonym Gene Names
ATH5; BHLHA13; bHLHa13; hATH5
UniProt Entry Name
ATOH7_HUMAN
NCBI Description
This intronless gene encodes a member of the basic helix-loop-helix family of transcription factors, with similarity to Drosophila atonal gene that controls photoreceptor development. Studies in mice suggest that this gene plays a central role in retinal ganglion cell and optic nerve formation. Mutations in this gene are associated with nonsyndromic congenital retinal nonattachment. [provided by RefSeq, Dec 2011]
Research Articles on ATOH7
Similar Products
Product Notes
The ATOH7 atoh7 (Catalog #AAA3202976) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATOH7 antibody - C-terminal region reacts with Cow, Dog, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's ATOH7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATOH7 atoh7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FGSERDWVGL HCEHFGRDHY LPFPGAKLPG ESELYSQRLF GFQPEPFQMA. It is sometimes possible for the material contained within the vial of "ATOH7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
