Western Blot (WB)
(WB Suggested Anti-DTNA AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)
Rabbit DTNA Polyclonal Antibody | anti-DTNA antibody
DTNA antibody - C-terminal region
Gene Names
DTNA; DTN; DRP3; DTN-A; LVNC1; D18S892E
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DTNA; Polyclonal Antibody; DTNA antibody - C-terminal region; anti-DTNA antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GATTSTMRGDMVTEDADPYVQPEDENYENDSVRQLENELQMEEYLKQKLQ
Sequence Length
452
Applicable Applications for anti-DTNA antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Rat: 92%; Yeast: 83%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-DTNA AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)
Western Blot (WB)
(WB Suggested Anti-DTNA AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)
Related Product Information for anti-DTNA antibody
This is a rabbit polyclonal antibody against DTNA. It was validated on Western Blot
Target Description: The protein encoded by this gene belongs to the dystrobrevin subfamily of the dystrophin family. This protein is a component of the dystrophin-associated protein complex (DPC), which consists of dystrophin and several integral and peripheral membrane proteins, including dystroglycans, sarcoglycans, syntrophins and alpha- and beta-dystrobrevin. The DPC localizes to the sarcolemma and its disruption is associated with various forms of muscular dystrophy. Mutations in this gene are associated with left ventricular noncompaction with congenital heart defects. Multiple alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
Target Description: The protein encoded by this gene belongs to the dystrobrevin subfamily of the dystrophin family. This protein is a component of the dystrophin-associated protein complex (DPC), which consists of dystrophin and several integral and peripheral membrane proteins, including dystroglycans, sarcoglycans, syntrophins and alpha- and beta-dystrobrevin. The DPC localizes to the sarcolemma and its disruption is associated with various forms of muscular dystrophy. Mutations in this gene are associated with left ventricular noncompaction with congenital heart defects. Multiple alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
Product Categories/Family for anti-DTNA antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
49kDa
NCBI Official Full Name
dystrobrevin alpha isoform 14
NCBI Official Synonym Full Names
dystrobrevin alpha
NCBI Official Symbol
DTNA
NCBI Official Synonym Symbols
DTN; DRP3; DTN-A; LVNC1; D18S892E
NCBI Protein Information
dystrobrevin alpha
Protein Family
NCBI Description
The protein encoded by this gene belongs to the dystrobrevin subfamily of the dystrophin family. This protein is a component of the dystrophin-associated protein complex (DPC), which consists of dystrophin and several integral and peripheral membrane proteins, including dystroglycans, sarcoglycans, syntrophins and alpha- and beta-dystrobrevin. The DPC localizes to the sarcolemma and its disruption is associated with various forms of muscular dystrophy. Mutations in this gene are associated with left ventricular noncompaction with congenital heart defects. Multiple alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Research Articles on DTNA
Similar Products
Product Notes
The DTNA (Catalog #AAA3215233) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DTNA antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's DTNA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DTNA for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GATTSTMRGD MVTEDADPYV QPEDENYEND SVRQLENELQ MEEYLKQKLQ. It is sometimes possible for the material contained within the vial of "DTNA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
