Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Sample Type: Rat brainAmount and Sample Type :500 ug rat brain homogenateAmount of IP Antibody :6 ugPrimary Antibody :DPYSL2Primary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:5000Gene Name :DPYSL2Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Rabbit DPYSL2 Polyclonal Antibody | anti-DPYSL2 antibody

DPYSL2 antibody - middle region

Gene Names
DPYSL2; DRP2; N2A3; CRMP2; DRP-2; ULIP2; CRMP-2; DHPRP2; ULIP-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunoprecipitation, Western Blot
Purity
Affinity Purified
Synonyms
DPYSL2; Polyclonal Antibody; DPYSL2 antibody - middle region; anti-DPYSL2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKR
Sequence Length
572
Applicable Applications for anti-DPYSL2 antibody
Immunoprecipitation (IP), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DPYSL2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunoprecipitation (IP)

(Sample Type: Rat brainAmount and Sample Type :500 ug rat brain homogenateAmount of IP Antibody :6 ugPrimary Antibody :DPYSL2Primary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:5000Gene Name :DPYSL2Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Immunoprecipitation (IP) (Sample Type: Rat brainAmount and Sample Type :500 ug rat brain homogenateAmount of IP Antibody :6 ugPrimary Antibody :DPYSL2Primary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:5000Gene Name :DPYSL2Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)
Related Product Information for anti-DPYSL2 antibody
This is a rabbit polyclonal antibody against DPYSL2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DPYSL2 belongs to the DHOase family. It is necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. The protein plays a role in axon guidance, neuronal growth cone collapse and cell migration.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
dihydropyrimidinase-related protein 2 isoform 2
NCBI Official Synonym Full Names
dihydropyrimidinase like 2
NCBI Official Symbol
DPYSL2
NCBI Official Synonym Symbols
DRP2; N2A3; CRMP2; DRP-2; ULIP2; CRMP-2; DHPRP2; ULIP-2
NCBI Protein Information
dihydropyrimidinase-related protein 2
UniProt Protein Name
Dihydropyrimidinase-related protein 2
UniProt Gene Name
DPYSL2
UniProt Synonym Gene Names
CRMP2; ULIP2; DRP-2; CRMP-2; ULIP-2
UniProt Entry Name
DPYL2_HUMAN

NCBI Description

This gene encodes a member of the collapsin response mediator protein family. Collapsin response mediator proteins form homo- and hetero-tetramers and facilitate neuron guidance, growth and polarity. The encoded protein promotes microtubule assembly and is required for Sema3A-mediated growth cone collapse, and also plays a role in synaptic signaling through interactions with calcium channels. This gene has been implicated in multiple neurological disorders, and hyperphosphorylation of the encoded protein may play a key role in the development of Alzheimer's disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Sep 2011]

Uniprot Description

CRMP-2: a microtubule-binding protein necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, neuronal growth cone collapse and cell migration. Homotetramer, and heterotetramer with CRMP1, CRMP-3, CRMP-4, or CRMP-5. Interacts through its C-terminus with the C-terminus of CYFIP1. Interacts with 5-hydroxytryptamine receptor 4 (5-HT(4)).

Protein type: Motility/polarity/chemotaxis; Microtubule-binding

Chromosomal Location of Human Ortholog: 8p22-p21

Cellular Component: microtubule; growth cone; cell soma; membrane; mitochondrion; dendrite; terminal button; cytosol

Molecular Function: protein binding; dihydropyrimidinase activity; protein kinase binding

Biological Process: response to drug; nervous system development; axon guidance; olfactory bulb development; response to amphetamine; synaptic vesicle transport; positive regulation of glutamate secretion; endocytosis; cytoskeleton organization and biogenesis; response to cocaine; signal transduction; pyrimidine base catabolic process; spinal cord development; nucleobase, nucleoside, nucleotide and nucleic acid metabolic process

Research Articles on DPYSL2

Similar Products

Product Notes

The DPYSL2 dpysl2 (Catalog #AAA3210532) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DPYSL2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DPYSL2 can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP), Western Blot (WB). Researchers should empirically determine the suitability of the DPYSL2 dpysl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NIFEGMECRG SPLVVISQGK IVLEDGTLHV TEGSGRYIPR KPFPDFVYKR. It is sometimes possible for the material contained within the vial of "DPYSL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.