Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Dpt AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Pancreas)

Rabbit Dpt Polyclonal Antibody | anti-DPT antibody

Dpt antibody - N-terminal region

Gene Names
Dpt; Eq1; EQ-1; 1810032B19Rik; 5033416F05Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Dpt; Polyclonal Antibody; Dpt antibody - N-terminal region; anti-DPT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GFSYQCPHGQVVVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEE
Sequence Length
201
Applicable Applications for anti-DPT antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 85%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Dpt AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Pancreas)

Western Blot (WB) (WB Suggested Anti-Dpt AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Pancreas)
Related Product Information for anti-DPT antibody
This is a rabbit polyclonal antibody against Dpt. It was validated on Western Blot

Target Description: Dpt seems to mediate adhesion by cell surface integrin binding. It may serve as a communication link between the dermal fibroblast cell surface and its extracellular matrix environment. It enhances TGFB1 activity and inhibits cell proliferation. Dpt accelerates collagen fibril formation, and stabilizes collagen fibrils against low-temperature dissociation.
Product Categories/Family for anti-DPT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
dermatopontin
NCBI Official Synonym Full Names
dermatopontin
NCBI Official Symbol
Dpt
NCBI Official Synonym Symbols
Eq1; EQ-1; 1810032B19Rik; 5033416F05Rik
NCBI Protein Information
dermatopontin
UniProt Protein Name
Dermatopontin
Protein Family
UniProt Gene Name
Dpt
UniProt Synonym Gene Names
EQ-1; TRAMP

Uniprot Description

Seems to mediate adhesion by cell surface integrin binding. May serve as a communication link between the dermal fibroblast cell surface and its extracellular matrix environment. Enhances TGFB1 activity (). Inhibits cell proliferation. Accelerates collagen fibril formation, and stabilizes collagen fibrils against low-temperature dissociation.

Research Articles on DPT

Similar Products

Product Notes

The DPT dpt (Catalog #AAA3206151) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Dpt antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Dpt can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DPT dpt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GFSYQCPHGQ VVVAVRSIFS KKEGSDRQWN YACMPTPQSL GEPTECWWEE. It is sometimes possible for the material contained within the vial of "Dpt, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.