Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DPPA5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: PANC1 cell lysate)

Rabbit DPPA5 Polyclonal Antibody | anti-DPPA5 antibody

DPPA5 antibody - N-terminal region

Gene Names
DPPA5; ESG1
Reactivity
Dog, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DPPA5; Polyclonal Antibody; DPPA5 antibody - N-terminal region; anti-DPPA5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV
Sequence Length
116
Applicable Applications for anti-DPPA5 antibody
Western Blot (WB)
Homology
Dog: 92%; Human: 100%; Mouse: 100%; Pig: 79%; Rabbit: 93%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DPPA5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DPPA5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: PANC1 cell lysate)

Western Blot (WB) (WB Suggested Anti-DPPA5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: PANC1 cell lysate)
Related Product Information for anti-DPPA5 antibody
This is a rabbit polyclonal antibody against DPPA5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DPPA5 is involved in the maintenance of embryonic stem (ES) cell pluripotency. DPPA5 is dispensable for self-renewal of pluripotent ES cells and establishment of germ cells. DPPA5 is associates with specific target mRNAs.
Product Categories/Family for anti-DPPA5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13kDa
NCBI Official Full Name
developmental pluripotency-associated 5 protein
NCBI Official Synonym Full Names
developmental pluripotency associated 5
NCBI Official Symbol
DPPA5
NCBI Official Synonym Symbols
ESG1
NCBI Protein Information
developmental pluripotency-associated 5 protein
UniProt Protein Name
Developmental pluripotency-associated 5 protein
UniProt Gene Name
DPPA5
UniProt Synonym Gene Names
ESG1; hDPPA5; ESG-1
UniProt Entry Name
DPPA5_HUMAN

NCBI Description

This gene encodes a protein that may function in the control of cell pluripotency and early embryogenesis. Expression of this gene is a specific marker for pluripotent stem cells. Pseudogenes of this gene are located on the short arm of chromosome 10 and the long arm of chromosomes 14 and 19. [provided by RefSeq, Dec 2010]

Uniprot Description

DPPA5: Involved in the maintenance of embryonic stem (ES) cell pluripotency. Dispensable for self-renewal of pluripotent ES cells and establishment of germ cells. Associates with specific target mRNAs. Belongs to the KHDC1 family.

Chromosomal Location of Human Ortholog: 6q13

Research Articles on DPPA5

Similar Products

Product Notes

The DPPA5 dppa5 (Catalog #AAA3214034) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DPPA5 antibody - N-terminal region reacts with Dog, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DPPA5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DPPA5 dppa5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MGTLPARRHI PPWVKVPEDL KDPEVFQVQT RLLKAIFGPD GSRIPYIEQV. It is sometimes possible for the material contained within the vial of "DPPA5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.