Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DPPA3Sample Type: Breast Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human DPPA3 Polyclonal Antibody | anti-DPPA3 antibody

DPPA3 Antibody - N-terminal region

Gene Names
DPPA3; Pgc7; STELLA
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DPPA3; Polyclonal Antibody; DPPA3 Antibody - N-terminal region; anti-DPPA3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DPSQFNPTYIPGSPQMLTEENSRDDSGASQISSETLIKNLSNLTINASSE
Sequence Length
159
Applicable Applications for anti-DPPA3 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human DPPA3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DPPA3Sample Type: Breast Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DPPA3Sample Type: Breast Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-DPPA3 antibody
This is a rabbit polyclonal antibody against DPPA3. It was validated on Western Blot

Target Description: This gene encodes a protein that in mice may function as a maternal factor during the preimplantation stage of development. In mice, this gene may play a role in transcriptional repression, cell division, and maintenance of cell pluripotentiality. In humans, related intronless loci are located on chromosomes 14 and X.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
developmental pluripotency-associated protein 3
NCBI Official Synonym Full Names
developmental pluripotency associated 3
NCBI Official Symbol
DPPA3
NCBI Official Synonym Symbols
Pgc7; STELLA
NCBI Protein Information
developmental pluripotency-associated protein 3
UniProt Protein Name
Developmental pluripotency-associated protein 3
UniProt Gene Name
DPPA3
UniProt Synonym Gene Names
STELLAR
UniProt Entry Name
DPPA3_HUMAN

NCBI Description

This gene encodes a protein that in mice may function as a maternal factor during the preimplantation stage of development. In mice, this gene may play a role in transcriptional repression, cell division, and maintenance of cell pluripotentiality. In humans, related intronless loci are located on chromosomes 14 and X. [provided by RefSeq, Jul 2008]

Uniprot Description

DPPA3: Primordial germ cell (PGCs)-specific protein involved in epigenetic chromatin reprogramming in the zygote following fertilization. In zygotes, DNA demethylation occurs selectively in the paternal pronucleus before the first cell division, while the adjacent maternal pronucleus and certain paternally-imprinted loci are protected from this process. Participates in protection of DNA methylation in the maternal pronucleus by preventing conversion of 5mC to 5hmC: specifically recognizes and binds histone H3 dimethylated at 'Lys-9' (H3K9me2) on maternal genome, and protects maternal genome from TET3-mediated conversion to 5hmC and subsequent DNA demethylation. Does not bind paternal chromatin, which is mainly packed into protamine and does not contain much H3K9me2 mark. Also protects imprinted loci that are marked with H3K9me2 in mature sperm from DNA demethylation in early embryogenesis. May be important for the totipotent/pluripotent states continuing through preimplantation development. Also involved in chromatin condensation in oocytogenesis.

Chromosomal Location of Human Ortholog: 12p13.31

Cellular Component: male pronucleus; cytoplasm; female pronucleus; nucleus

Molecular Function: methylated histone residue binding

Biological Process: chromatin modification; embryonic cleavage

Research Articles on DPPA3

Similar Products

Product Notes

The DPPA3 dppa3 (Catalog #AAA3214071) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DPPA3 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DPPA3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DPPA3 dppa3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DPSQFNPTYI PGSPQMLTEE NSRDDSGASQ ISSETLIKNL SNLTINASSE. It is sometimes possible for the material contained within the vial of "DPPA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.