Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DPF2 Antibody Titration: 0.3125ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateDPF2 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit DPF2 Polyclonal Antibody | anti-DPF2 antibody

DPF2 antibody - N-terminal region

Gene Names
DPF2; REQ; CSS7; UBID4; ubi-d4
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
DPF2; Polyclonal Antibody; DPF2 antibody - N-terminal region; anti-DPF2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQ
Sequence Length
391
Applicable Applications for anti-DPF2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DPF2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DPF2 Antibody Titration: 0.3125ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateDPF2 is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (WB Suggested Anti-DPF2 Antibody Titration: 0.3125ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateDPF2 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-DPF2 antibody
This is a rabbit polyclonal antibody against DPF2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DPF2 is a member of the d4 domain family, characterized by a zinc finger-like structural motif. DPF2 functions as a transcription factor which is necessary for the apoptotic response following deprivation of survival factors. It likely serves a regulatory
Product Categories/Family for anti-DPF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
zinc finger protein ubi-d4 isoform 1
NCBI Official Synonym Full Names
double PHD fingers 2
NCBI Official Symbol
DPF2
NCBI Official Synonym Symbols
REQ; CSS7; UBID4; ubi-d4
NCBI Protein Information
zinc finger protein ubi-d4
UniProt Protein Name
Zinc finger protein ubi-d4
Protein Family
UniProt Gene Name
DPF2
UniProt Synonym Gene Names
BAF45D; REQ; UBID4; BAF45D
UniProt Entry Name
REQU_HUMAN

NCBI Description

The protein encoded by this gene is a member of the d4 domain family, characterized by a zinc finger-like structural motif. This protein functions as a transcription factor which is necessary for the apoptotic response following deprivation of survival factors. It likely serves a regulatory role in rapid hematopoietic cell growth and turnover. This gene is considered a candidate gene for multiple endocrine neoplasia type I, an inherited cancer syndrome involving multiple parathyroid, enteropancreatic, and pituitary tumors. [provided by RefSeq, Jul 2008]

Uniprot Description

requiem: May be a transcription factor required for the apoptosis response following survival factor withdrawal from myeloid cells. Might also have a role in the development and maturation of lymphoid cells. Belongs to the requiem/DPF family.

Protein type: Apoptosis; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: nucleoplasm; centrosome; intracellular membrane-bound organelle; cytoplasm; nuclear chromatin

Molecular Function: zinc ion binding

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent; apoptosis

Research Articles on DPF2

Similar Products

Product Notes

The DPF2 dpf2 (Catalog #AAA3204265) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DPF2 antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DPF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DPF2 dpf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAAVVENVVK LLGEQYYKDA MEQCHNYNAR LCAERSVRLP FLDSQTGVAQ. It is sometimes possible for the material contained within the vial of "DPF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.