Mouse CLK3 Monoclonal Antibody | anti-CLK3 antibody

CLK3 (CDC-like Kinase 3, FLJ22858, PHCLK3, PHCLK3/152) (HRP)

Cat. Num. AAA6179195

• Gene Names: CLK3; PHCLK3; PHCLK3/152
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: CLK3; Monoclonal Antibody; CLK3 (CDC-like Kinase 3; FLJ22858; PHCLK3; PHCLK3/152) (HRP); CDC-like Kinase 3; PHCLK3/152; anti-CLK3 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 5B2
• Specificity: Recognizes CLK3.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 490

• Applicable Applications for anti-CLK3 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: CLK3 (AAH02555, 36aa-136aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: YPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSV
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to CLK3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CLK3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CLK3 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CLK3 on HeLa cell. [antibody concentration 10 ug/ml])

Western Blot (WB)

(CLK3 monoclonal antibody (M04), clone 5B2 Western Blot analysis of CLK3 expression in MCF-7 (Cat # L046V1).)

Product Categories/Family for anti-CLK3 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 12803461
• NCBI GeneID: 1198
• NCBI Official Full Name: CDC-like kinase 3
• NCBI Official Synonym Full Names: CDC like kinase 3
• NCBI Official Symbol: CLK3
• NCBI Official Synonym Symbols: PHCLK3; PHCLK3/152
• NCBI Protein Information: dual specificity protein kinase CLK3
• Protein Family: Dual specificity protein kinase

NCBI Description

This gene encodes a protein belonging to the serine/threonine type protein kinase family. This protein is a nuclear dual-specificity kinase that regulates the intranuclear distribution of the serine/arginine-rich (SR) family of splicing factors. Two transcript variants encoding different isoforms have been found for this gene. Related pseudogenes are located on chromosomes 1 and 9. [provided by RefSeq, Jul 2008]