Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DOLPP1 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateDOLPP1 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit DOLPP1 Polyclonal Antibody | anti-DOLPP1 antibody

DOLPP1 antibody - N-terminal region

Gene Names
DOLPP1; LSFR2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DOLPP1; Polyclonal Antibody; DOLPP1 antibody - N-terminal region; anti-DOLPP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLI
Sequence Length
238
Applicable Applications for anti-DOLPP1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DOLPP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DOLPP1 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateDOLPP1 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (WB Suggested Anti-DOLPP1 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateDOLPP1 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-DOLPP1 antibody
This is a rabbit polyclonal antibody against DOLPP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DOLPP1 is a multi-pass membrane proteinBy similarity. It belongs to the dolichyldiphosphatase family. It is required for efficient N-glycosylation and is necessary for maintaining optimal levels of dolichol-linked oligosaccharides. DOLPP1 hydrolyzes dolichyl pyrophosphate at a very high rate and dolichyl monophosphate at a much lower rate. It does not act on phosphatidate.
Product Categories/Family for anti-DOLPP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
dolichyldiphosphatase 1 isoform a
NCBI Official Synonym Full Names
dolichyldiphosphatase 1
NCBI Official Symbol
DOLPP1
NCBI Official Synonym Symbols
LSFR2
NCBI Protein Information
dolichyldiphosphatase 1
UniProt Protein Name
Dolichyldiphosphatase 1
Protein Family
UniProt Gene Name
DOLPP1
UniProt Synonym Gene Names
LSFR2
UniProt Entry Name
DOPP1_HUMAN

NCBI Description

A similar gene has been characterized in mice and encodes dolichyl pyrophosphate (Dol-P-P) phosphatase. This protein dephosphorylates dolichyl pyrophosphate so that it may be re-utilized as a glycosyl carrier lipid by the oligosaccharyltransferase multisubunit complex in the ER. Alternative splicing results in multiple transcript variants and protein isoforms. [provided by RefSeq, Jun 2012]

Uniprot Description

DOLPP1: Required for efficient N-glycosylation. Necessary for maintaining optimal levels of dolichol-linked oligosaccharides. Hydrolyzes dolichyl pyrophosphate at a very high rate and dolichyl monophosphate at a much lower rate. Does not act on phosphatidate. Belongs to the dolichyldiphosphatase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase; Endoplasmic reticulum; Membrane protein, multi-pass; Membrane protein, integral; Glycan Metabolism - N-glycan biosynthesis; EC 3.6.1.43

Chromosomal Location of Human Ortholog: 9q34.1

Cellular Component: endoplasmic reticulum membrane; integral to endoplasmic reticulum membrane

Molecular Function: dolichyldiphosphatase activity

Biological Process: cellular protein metabolic process; dolichol-linked oligosaccharide biosynthetic process; dolichyl diphosphate biosynthetic process; lipid biosynthetic process; protein amino acid N-linked glycosylation; protein amino acid N-linked glycosylation via asparagine; post-translational protein modification

Similar Products

Product Notes

The DOLPP1 dolpp1 (Catalog #AAA3209494) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DOLPP1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DOLPP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DOLPP1 dolpp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AADGQCSLPA SWRPVTLTHV EYPAGDLSGH LLAYLSLSPV FVIVGFVTLI. It is sometimes possible for the material contained within the vial of "DOLPP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.