Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DOLKSample Tissue: Mouse Heart lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse DOLK Polyclonal Antibody | anti-DOLK antibody

DOLK Antibody-middle region

Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DOLK; Polyclonal Antibody; DOLK Antibody-middle region; dolichol kinase; Tmem15; BC026973; mKIAA1094; anti-DOLK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
LASVACLVVLYQNAKRSSSESKKHRAPTITRKYFHFIVVATYIPGIIFDR
Applicable Applications for anti-DOLK antibody
Western Blot (WB)
Protein Size
534 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse DOLK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DOLKSample Tissue: Mouse Heart lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DOLKSample Tissue: Mouse Heart lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-DOLK antibody
Description of Target: Involved in the synthesis of the sugar donor Dol-P-Man which is required in the synthesis of N-linked and O-linked oligosaccharides and for that of GPI anchors.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
58kDa
UniProt Protein Name
Dolichol kinase
UniProt Gene Name
Dolk
UniProt Synonym Gene Names
Tmem15
UniProt Entry Name
DOLK_MOUSE

Uniprot Description

DOLK: Involved in the synthesis of the sugar donor Dol-P-Man which is required in the synthesis of N-linked and O-linked oligosaccharides and for that of GPI anchors. Defects in DOLK are the cause of congenital disorder of glycosylation type 1M (CDG1M); also known as dolichol kinase deficiency. CDGs are a family of severe inherited diseases caused by a defect in glycoprotein biosynthesis. They are characterized by under-glycosylated serum glycoproteins. These multisystem disorders present with a wide variety of clinical features, such as disorders of the nervous system development, psychomotor retardation, dysmorphic features, hypotonia, coagulation disorders, and immunodeficiency. The broad spectrum of features reflects the critical role of N-glycoproteins during embryonic development, differentiation, and maintenance of cell functions. CDG1M is a very severe disorder with death occurring in early infancy. Belongs to the polyprenol kinase family.

Protein type: Kinase, other; Membrane protein, multi-pass; Endoplasmic reticulum; EC 2.7.1.108; Membrane protein, integral

Cellular Component: membrane; endoplasmic reticulum; integral to membrane; integral to endoplasmic reticulum membrane

Molecular Function: transferase activity; dolichol kinase activity; kinase activity

Biological Process: dolichyl monophosphate biosynthetic process; phosphorylation

Similar Products

Product Notes

The DOLK dolk (Catalog #AAA3249865) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DOLK Antibody-middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's DOLK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DOLK dolk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LASVACLVVL YQNAKRSSSE SKKHRAPTIT RKYFHFIVVA TYIPGIIFDR. It is sometimes possible for the material contained within the vial of "DOLK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.