Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of DOCK7 expression in transfected 293T cell line by DOCK7 polyclonal antibody. Lane 1: DOCK7 transfected lysate (68.64kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human DOCK7 Polyclonal Antibody | anti-DOCK7 antibody

DOCK7 (Dedicator of Cytokinesis Protein 7, KIAA1771, ZIR2)

Gene Names
DOCK7; ZIR2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
DOCK7; Polyclonal Antibody; DOCK7 (Dedicator of Cytokinesis Protein 7; KIAA1771; ZIR2); Anti -DOCK7 (Dedicator of Cytokinesis Protein 7; anti-DOCK7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human DOCK7.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MACNQSAVYLQHCFATQRALVSKFPELLFEEETEQCADLCLRLLRHCSSSIGTIRSHASASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSQNFNEEFLRRSLKTILTYAEEDLELRETTFPDQVQDLVFNLHMILSDTVKMKEHQEDPEMLIDLMYRIAKGYQTSPDLRLTWLQNMAGKHSERSNHAEAAQCLVHSAALVAEYLSMLEDRKYLPVGCVTFQNISSNVLEESAVSDDVVSPDEEGICSGKYFTESGLVGLLEQAAASFSMAGMYEAVNEVYKVLIPIHEANRDAKKLSTIHGKLQEAFSKIVHQDGKRMFGTYFRVGFYGTKFGDLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDVVEVIKDSNPVDKCKLDPNKAYIQITYVEPYFDTYEMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLINRKIPQLYKAVLPVTCHRDSFSRMSLRKMDL
Applicable Applications for anti-DOCK7 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human DOCK7, aa1-624 (AAH16392.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of DOCK7 expression in transfected 293T cell line by DOCK7 polyclonal antibody. Lane 1: DOCK7 transfected lysate (68.64kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DOCK7 expression in transfected 293T cell line by DOCK7 polyclonal antibody. Lane 1: DOCK7 transfected lysate (68.64kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-DOCK7 antibody
Functions as a guanine nucleotide exchange factor (GEF), which activates Rac1 and Rac3 Rho small GTPases by exchanging bound GDP for free GTP. Does not have a GEF activity for CDC42. Required for STMN1 'Ser-15' phosphorylation during axon formation and consequently for neuronal polarization.
Product Categories/Family for anti-DOCK7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
242,561 Da
NCBI Official Full Name
dedicator of cytokinesis protein 7 isoform 4
NCBI Official Synonym Full Names
dedicator of cytokinesis 7
NCBI Official Symbol
DOCK7
NCBI Official Synonym Symbols
ZIR2
NCBI Protein Information
dedicator of cytokinesis protein 7
UniProt Protein Name
Dedicator of cytokinesis protein 7
UniProt Gene Name
DOCK7
UniProt Synonym Gene Names
KIAA1771
UniProt Entry Name
DOCK7_HUMAN

NCBI Description

The protein encoded by this gene is a guanine nucleotide exchange factor (GEF) that plays a role in axon formation and neuronal polarization. The encoded protein displays GEF activity toward RAC1 and RAC3 Rho small GTPases but not toward CDC42. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2012]

Uniprot Description

DOCK7: a guanine nucleotide exchange factor (GEF) that activates Rac GTPase but not CDC42. Expressed at high levels in the brain and heart. Selectively expressed in the axons and positively regulates axon formation. Knockdown of DOCK7 expression prevents axon formation and overexpression induces formation of multiple axons. Three alternatively-spliced isoforms have been described.

Protein type: GEFs; GEFs, misc.

Chromosomal Location of Human Ortholog: 1p31.3

Cellular Component: signalosome; neuron projection; focal adhesion; growth cone; axon

Molecular Function: guanyl-nucleotide exchange factor activity; Rac GTPase binding

Biological Process: regulation of neurogenesis; axonogenesis; pigmentation; establishment of neuroblast polarity; small GTPase mediated signal transduction; hemopoietic progenitor cell differentiation; microtubule cytoskeleton organization and biogenesis; positive regulation of peptidyl-serine phosphorylation; interkinetic nuclear migration; neurite development

Disease: Epileptic Encephalopathy, Early Infantile, 23

Research Articles on DOCK7

Similar Products

Product Notes

The DOCK7 dock7 (Catalog #AAA6009141) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DOCK7 (Dedicator of Cytokinesis Protein 7, KIAA1771, ZIR2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DOCK7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the DOCK7 dock7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MACNQSAVYL QHCFATQRAL VSKFPELLFE EETEQCADLC LRLLRHCSSS IGTIRSHASA SLYLLMRQNF EIGNNFARVK MQVTMSLSSL VGTSQNFNEE FLRRSLKTIL TYAEEDLELR ETTFPDQVQD LVFNLHMILS DTVKMKEHQE DPEMLIDLMY RIAKGYQTSP DLRLTWLQNM AGKHSERSNH AEAAQCLVHS AALVAEYLSM LEDRKYLPVG CVTFQNISSN VLEESAVSDD VVSPDEEGIC SGKYFTESGL VGLLEQAAAS FSMAGMYEAV NEVYKVLIPI HEANRDAKKL STIHGKLQEA FSKIVHQDGK RMFGTYFRVG FYGTKFGDLD EQEFVYKEPA ITKLAEISHR LEGFYGERFG EDVVEVIKDS NPVDKCKLDP NKAYIQITYV EPYFDTYEMK DRITYFDKNY NLRRFMYCTP FTLDGRAHGE LHEQFKRKTI LTTSHAFPYI KTRVNVTHKE EIILTPIEVA IEDMQKKTQE LAFATHQDPA DPKMLQMVLQ GSVGTTVNQG PLEVAQVFLS EIPSDPKLFR HHNKLRLCFK DFTKRCEDAL RKNKSLIGPD QKEYQRELER NYHRLKEALQ PLINRKIPQL YKAVLPVTCH RDSFSRMSLR KMDL. It is sometimes possible for the material contained within the vial of "DOCK7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.