Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DNTT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)

Rabbit DNTT Polyclonal Antibody | anti-DNTT antibody

DNTT antibody - middle region

Gene Names
DNTT; TDT
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DNTT; Polyclonal Antibody; DNTT antibody - middle region; anti-DNTT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LRRYATHERKMILDNHALYDKTKRIFLKAESEEEIFAHLGLDYIEPWERN
Sequence Length
509
Applicable Applications for anti-DNTT antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 91%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DNTT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DNTT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-DNTT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)
Related Product Information for anti-DNTT antibody
This is a rabbit polyclonal antibody against DNTT. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DNTT is the template-independent DNA polymerase which catalyzes the random addition of deoxynucleoside 5'-triphosphate to the 3'-end of a DNA initiator. One of the in vivo functions of this enzyme is the addition of nucleotides at the junction (N region) of rearranged Ig heavy chain and T-cell receptor gene segments during the maturation of B- and T-cells.This gene is a member of the DNA polymerase type-X family and encodes a template-independent DNA polymerase that catalyzes the addition of deoxynucleotides to the 3'-hydroxyl terminus of oligonucleotide primers. In vivo, the encoded protein is expressed in a restricted population of normal and malignant pre-B and pre-T lymphocytes during early differentiation, where it generates antigen receptor diversity by synthesizing non-germ line elements (N-regions) at the junctions of rearranged Ig heavy chain and T cell receptor gene segments. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
DNA nucleotidylexotransferase isoform 1
NCBI Official Synonym Full Names
DNA nucleotidylexotransferase
NCBI Official Symbol
DNTT
NCBI Official Synonym Symbols
TDT
NCBI Protein Information
DNA nucleotidylexotransferase
UniProt Protein Name
DNA nucleotidylexotransferase
UniProt Gene Name
DNTT
UniProt Synonym Gene Names
TDT; Terminal transferase
UniProt Entry Name
TDT_HUMAN

NCBI Description

This gene is a member of the DNA polymerase type-X family and encodes a template-independent DNA polymerase that catalyzes the addition of deoxynucleotides to the 3'-hydroxyl terminus of oligonucleotide primers. In vivo, the encoded protein is expressed in a restricted population of normal and malignant pre-B and pre-T lymphocytes during early differentiation, where it generates antigen receptor diversity by synthesizing non-germ line elements (N-regions) at the junctions of rearranged Ig heavy chain and T cell receptor gene segments. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

DNTT: Template-independent DNA polymerase which catalyzes the random addition of deoxynucleoside 5'-triphosphate to the 3'-end of a DNA initiator. One of the in vivo functions of this enzyme is the addition of nucleotides at the junction (N region) of rearranged Ig heavy chain and T-cell receptor gene segments during the maturation of B- and T-cells. Belongs to the DNA polymerase type-X family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transferase; EC 2.7.7.31

Chromosomal Location of Human Ortholog: 10q23-q24

Cellular Component: nucleoplasm; cytoplasm

Molecular Function: DNA binding; metal ion binding; DNA nucleotidylexotransferase activity; DNA-directed DNA polymerase activity

Biological Process: DNA modification

Research Articles on DNTT

Similar Products

Product Notes

The DNTT dntt (Catalog #AAA3210567) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DNTT antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DNTT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DNTT dntt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LRRYATHERK MILDNHALYD KTKRIFLKAE SEEEIFAHLG LDYIEPWERN. It is sometimes possible for the material contained within the vial of "DNTT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.