Mouse anti-Human GUCY2C Monoclonal Antibody | anti-Gucy2c antibody

GUCY2C (Heat-stable Enterotoxin Receptor [Precursor], GC-C, Intestinal Guanylate Cyclase, STA Receptor, hSTAR, GUCY2C, GUC2C, STAR)

Cat. Num. AAA6007409

• Gene Names: Gucy2c; Gcc; GC-C; AI893437
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: GUCY2C; Monoclonal Antibody; GUCY2C (Heat-stable Enterotoxin Receptor [Precursor]; GC-C; Intestinal Guanylate Cyclase; STA Receptor; hSTAR; GUC2C; STAR); Anti -GUCY2C (Heat-stable Enterotoxin Receptor [Precursor]; anti-Gucy2c antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1B11
• Specificity: Recognizes human GUCY2C.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: SQVSQNCHNGSYEISVLMMGNSAFAEPLKNLEDAVNEGLEIVRGRLQNAGLNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISNAQRMGCVLIGPSCTYSTFQMYL

• Applicable Applications for anti-Gucy2c antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa24-133 from human GUCY2C with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB)

(Western Blot analysis of GUCY2C expression in 293 cells using MBS6007409.)

Testing Data

(Detection limit for MBS6007409 is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-Gucy2c antibody

Guanylyl cyclase C (GUCY2C) is a transmembrane receptor expressed primarily in the intestine that regulates chloride secretion via the cystic fibrosis transmembrane conductance regulator. Binding of GUCY2C to either the endogenous peptide guanylin or the bacterially derived heat-stable enterotoxin STa, results in increased levels of cGMP and the stimulation of water and chloride secretion. In the case of exposure to STa, this leads to debilitating secretory diarrhea.

Product Categories/Family for anti-Gucy2c antibody

Antibodies; Abs to Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 21707860
• NCBI GeneID: 14917
• UniProt Accession #: Q3UWA6; Q499D2; Q8JZQ6
• Molecular Weight: 123,232 Da
• NCBI Official Full Name: Gucy2c protein, partial
• NCBI Official Synonym Full Names: guanylate cyclase 2c
• NCBI Official Symbol: Gucy2c
• NCBI Official Synonym Symbols: Gcc; GC-C; AI893437
• NCBI Protein Information: heat-stable enterotoxin receptor; STA receptor; guanylyl cyclase C; intestinal guanylate cyclase; heat stable enterotoxin receptor
• UniProt Protein Name: Heat-stable enterotoxin receptor
• Protein Family: Heat-stable enterotoxin receptor
• UniProt Gene Name: Gucy2c
• UniProt Synonym Gene Names: Guc2c; STA receptor; GC-C
• UniProt Entry Name: GUC2C_MOUSE

Uniprot Description

GUCY2C: Receptor for the E.coli heat-stable enterotoxin (E.coli enterotoxin markedly stimulates the accumulation of cGMP in mammalian cells expressing GC-C). Also activated by the endogenous peptide guanylin. Defects in GUCY2C are the cause of diarrhea type 6 (DIAR6). A relatively mild, early-onset chronic diarrhea that may be associated with increased susceptibility to inflammatory bowel disease, small-bowel obstruction, and esophagitis. Defects in GUCY2C are a cause of meconium ileus (MECIL). A condition characterized by a intestinal obstruction due to inspissated meconium in the distal ileum and cecum, which develops in utero and presents shortly after birth as a failure to pass meconium. Meconium ileus is a known clinical manifestation of cystic fibrosis. Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.

Protein type: Receptor, misc.; Guanylyl cyclase; Protein kinase, RGC; Nucleotide Metabolism - purine; Lyase; Protein kinase, dual-specificity (receptor); Membrane protein, integral; Kinase, protein; EC 4.6.1.2; RGC group; RGC family

Cellular Component: membrane; endoplasmic reticulum; integral to membrane; plasma membrane

Molecular Function: toxin binding; guanylate cyclase activity; GTP binding; phosphorus-oxygen lyase activity; transferase activity, transferring phosphorus-containing groups; nucleotide binding; lyase activity; ATP binding; protein kinase activity

Biological Process: cGMP biosynthetic process; cyclic nucleotide biosynthetic process; response to toxin; protein amino acid phosphorylation; regulation of cell proliferation