Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using DNAJC9 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

Rabbit DNAJC9 Polyclonal Antibody | anti-DNAJC9 antibody

DNAJC9 Polyclonal Antibody

Gene Names
DNAJC9; JDD1; SB73; HDJC9
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purification
Synonyms
DNAJC9; Polyclonal Antibody; DNAJC9 Polyclonal Antibody; HDJC9; JDD1; SB73; anti-DNAJC9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MGLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLSDREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYTEEPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKSSKGGGKKSAL
Sequence Length
260
Applicable Applications for anti-DNAJC9 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500 - 1:2000
IHC: 1:50 - 1:200
Immunogen
Recombinant protein of human DNAJC9
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell membrane, Cytoplasm, Nucleus
Positive Samples
293T, OVCAR-3, HepG2, HT-29, K-562
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using DNAJC9 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using DNAJC9 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Product Categories/Family for anti-DNAJC9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 29kDa
Observed: 36kDa
NCBI Official Full Name
dnaJ homolog subfamily C member 9
NCBI Official Synonym Full Names
DnaJ heat shock protein family (Hsp40) member C9
NCBI Official Symbol
DNAJC9
NCBI Official Synonym Symbols
JDD1; SB73; HDJC9
NCBI Protein Information
dnaJ homolog subfamily C member 9
UniProt Protein Name
DnaJ homolog subfamily C member 9
Protein Family
UniProt Gene Name
DNAJC9
UniProt Synonym Gene Names
HDJC9

Uniprot Description

May play a role as co-chaperone of the Hsp70 family proteins HSPA1A, HSPA1B and HSPA8.

Research Articles on DNAJC9

Similar Products

Product Notes

The DNAJC9 dnajc9 (Catalog #AAA9133224) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DNAJC9 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DNAJC9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500 - 1:2000 IHC: 1:50 - 1:200. Researchers should empirically determine the suitability of the DNAJC9 dnajc9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGLLDLCEEV FGTADLYRVL GVRREASDGE VRRGYHKVSL QVHPDRVGEG DKEDATRRFQ ILGKVYSVLS DREQRAVYDE QGTVDEDSPV LTQDRDWEAY WRLLFKKISL EDIQAFEKTY KGSEEELADI KQAYLDFKGD MDQIMESVLC VQYTEEPRIR NIIQQAIDAG EVPSYNAFVK ESKQKMNARK RRAQEEAKEA EMSRKELGLD EGVDSLKAAI QSRQKDRQKE MDNFLAQMEA KYCKSSKGGG KKSAL. It is sometimes possible for the material contained within the vial of "DNAJC9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.