Western Blot (WB)
(DNAJC7 rabbit polyclonal antibody. Western Blot analysis of DNAJC7 expression in human liver.)
Rabbit anti-Human, Mouse DNAJC7 Polyclonal Antibody | anti-DNAJC7 antibody
DNAJC7 (DnaJ Homolog Subfamily C Member 7, Tetratricopeptide Repeat Protein 2, TPR rEpeat Protein 2, TPR2, TTC2) (HRP)
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DNAJC7; Polyclonal Antibody; DNAJC7 (DnaJ Homolog Subfamily C Member 7; Tetratricopeptide Repeat Protein 2; TPR rEpeat Protein 2; TPR2; TTC2) (HRP); anti-DNAJC7 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human DNAJC7. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Sequence Length
484
Applicable Applications for anti-DNAJC7 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human DNAJC7, aa1-484 (NP_003306.1).
Immunogen Sequence
MAATEPELLDDQEAKREAETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDPNNIFKAFFGGPGGFSFEASGPGNFFFQFG
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(DNAJC7 rabbit polyclonal antibody. Western Blot analysis of DNAJC7 expression in human liver.)
Western Blot (WB)
(DNAJC7 rabbit polyclonal antibody. Western Blot analysis of DNAJC7 expression in human liver.)
Western Blot (WB)
(DNAJC7 rabbit polyclonal antibody. Western Blot analysis of DNAJC7 expression in mouse liver.)
Western Blot (WB)
(DNAJC7 rabbit polyclonal antibody. Western Blot analysis of DNAJC7 expression in mouse liver.)
Western Blot (WB)
(Western Blot analysis of DNAJC7 expression in transfected 293T cell line by DNAJC7 polyclonal antibody. Lane 1: DNAJC7 transfected lysate (55.5kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of DNAJC7 expression in transfected 293T cell line by DNAJC7 polyclonal antibody. Lane 1: DNAJC7 transfected lysate (55.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-DNAJC7 antibody
Acts as co-chaperone regulating the molecular chaperones HSP70 and HSP90 in folding of steroid receptors, such as the glucocorticoid receptor and the progesterone receptor. Proposed to act as a recycling chaperone by facilitating the return of chaperone substrates to early stages of chaperoning if further folding is required. In vitro, induces ATP-independent dissociation of HSP90 but not of HSP70 from the chaperone-substrate complexes. Recruits NR1I3 to the cytoplasm.
Product Categories/Family for anti-DNAJC7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
DnaJ (Hsp40) homolog, subfamily C, member 7
Protein Family
Similar Products
Product Notes
The DNAJC7 (Catalog #AAA6376451) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DNAJC7 (DnaJ Homolog Subfamily C Member 7, Tetratricopeptide Repeat Protein 2, TPR rEpeat Protein 2, TPR2, TTC2) (HRP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's DNAJC7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DNAJC7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DNAJC7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
