Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of DNAJC5B expression in transfected 293T cell line by DNAJC5B polyclonal antibody. Lane 1: DNAJC5B transfected lysate (21.89kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human DNAJC5B Polyclonal Antibody | anti-DNAJC5B antibody

DNAJC5B (DnaJ Homolog Subfamily C Member 5B, Cysteine String Protein beta, CSP-beta, MGC26226)

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
DNAJC5B; Polyclonal Antibody; DNAJC5B (DnaJ Homolog Subfamily C Member 5B; Cysteine String Protein beta; CSP-beta; MGC26226); Anti -DNAJC5B (DnaJ Homolog Subfamily C Member 5B; anti-DNAJC5B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human DNAJC5B.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYRKLALKHHPDKNPDDPAATEKFKEINNAHAILTDISKRSIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKALFVIVGLLTGCYFCCCLCCCCNCCCGHCRPESSVPEEDFYVSPEDLEEQIKSDMEKDVDFPVFLQPTNANEKTQLIKEGSRSYCTDS
Applicable Applications for anti-DNAJC5B antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human DNAJC5B, aa1-199 (NP_149096).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of DNAJC5B expression in transfected 293T cell line by DNAJC5B polyclonal antibody. Lane 1: DNAJC5B transfected lysate (21.89kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DNAJC5B expression in transfected 293T cell line by DNAJC5B polyclonal antibody. Lane 1: DNAJC5B transfected lysate (21.89kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-DNAJC5B antibody
Interacts with the chaperone complex consisting of HSC70 and SGTA.
Product Categories/Family for anti-DNAJC5B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,691 Da
NCBI Official Full Name
dnaJ homolog subfamily C member 5B
NCBI Official Synonym Full Names
DnaJ (Hsp40) homolog, subfamily C, member 5 beta
NCBI Official Symbol
DNAJC5B
NCBI Protein Information
dnaJ homolog subfamily C member 5B; CSP-beta; cysteine string protein beta
UniProt Protein Name
DnaJ homolog subfamily C member 5B
Protein Family
UniProt Gene Name
DNAJC5B
UniProt Synonym Gene Names
CSP-beta
UniProt Entry Name
DNJ5B_BOVIN

Uniprot Description

Subunit structure: Interacts with the chaperone complex consisting of HSC70 and SGTA

By similarity.

Subcellular location: Membrane; Lipid-anchor

By similarity.

Post-translational modification: Palmitoylated

By similarity.

Sequence similarities: Contains 1 J domain.

Similar Products

Product Notes

The DNAJC5B dnajc5b (Catalog #AAA641950) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DNAJC5B (DnaJ Homolog Subfamily C Member 5B, Cysteine String Protein beta, CSP-beta, MGC26226) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DNAJC5B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the DNAJC5B dnajc5b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MACNIPNQRQ RTLSTTGEAL YEILGLHKGA SNEEIKKTYR KLALKHHPDK NPDDPAATEK FKEINNAHAI LTDISKRSIY DKYGSLGLYV AEQFGDENVN TYFMLSSWWA KALFVIVGLL TGCYFCCCLC CCCNCCCGHC RPESSVPEED FYVSPEDLEE QIKSDMEKDV DFPVFLQPTN ANEKTQLIKE GSRSYCTDS. It is sometimes possible for the material contained within the vial of "DNAJC5B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.